KEGG   Desulfotomaculum gibsoniae: Desgi_0898Help
Entry
Desgi_0898        CDS       T02657                                 

Definition
alcohol dehydrogenase, class IV
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Desgi_0898
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desgi_0898
   00620 Pyruvate metabolism
    Desgi_0898
   00650 Butanoate metabolism
    Desgi_0898
  Lipid metabolism
   00071 Fatty acid degradation
    Desgi_0898
  Amino acid metabolism
   00350 Tyrosine metabolism
    Desgi_0898
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Desgi_0898
   00626 Naphthalene degradation
    Desgi_0898
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Desgi_0898
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Desgi_0898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
920393..923011
Genome map
AA seq 872 aa AA seqDB search
MSEQNNGRQIEYIGDQQQLMVDKLVENAEQARHALMRLSQQQIDEIVRAMALAGLDQHME
LAKLAVEETKKGVYEDKSIKNMFATESVYHSIKYKKTVGVIRVNEEEDLMEVAEPVGVIA
AVIPVTNPTSTTMFKSLICIKTANPVIFSFHPGGQKCSAAAAKVMLDAAVAAGAPENCIG
WIEESSLEATRYLMNHPGVQLILATGGAGLVQAAYSTGKPALGVGPGNVPCYIEKTAHIK
RAVTDLILSKTFDNGLICASEQSVIIDREVFQEVTGLMKTYGCYFLNDQETAKLEAMAVK
GEDCALNSAIVGQTAYDIAQMAGFEVPRAAKVLVAPQQGVGPGYPLSMEKLSPILACYQV
DDYREGISRCEEIVGFGGLGHSAVLHTEDKDVVAEFSRRMRTGRIIINSPATHGAIGDLY
NVNIPSLTLGCGSMGHNATTSNVSVDNLINIKRVTGRRNKLQWFKVPERIYFTSGSVQYL
QKMQGIARVIIVTDPGIVKLGFVDKVVYHLNKRNNQVSVEIFSDVEPDPSVETVQKGVEI
MKQFRPDTIIALGGGSPIDAAKAMWLFYEHPEVEFDFLRLKFLDIRKRTYKYPKLGRQAQ
FVAIPTTSGTGSEVSAFAVITHKGQDIKYPLADYELTPDVAIIDPDFVGTLPPAVIADTG
LDVLTHALEAYVSVMASDYTDAMAMKATELVFKYLPASYGEKDNFTARSKMHNASCIAGM
AFTNAFLGVCHSLAHKLGGEFHITHGRANAIMLPHVIRYNAGMPSKFTSFPQYEYFQAPE
KYRQMAAFLGMPAGTVEEGVNSLIAGVERLRSGVGIPDTIAQCDIDAALFKQKVPELAEK
AFVDQSTTANPRMPLIEELAEILLRAYDNPHA
NT seq 2619 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagcaaaataacggtcggcagattgaatatatcggtgatcaacaacagttaatg
gtggataaactggtggaaaatgctgagcaggcacggcatgctttaatgcgcttgtctcag
cagcaaattgatgaaatagtacgggccatggccctggccggtttggatcagcatatggaa
ctggccaagctggcggttgaggaaaccaaaaagggcgtctacgaagataaatctataaaa
aacatgtttgccacggaatccgtctaccatagcatcaagtacaaaaaaaccgtaggggta
atcagggttaacgaagaagaagatttaatggaggtggccgagcccgtgggggtgattgcc
gccgtaattcccgtaaccaaccccacttccaccaccatgttcaaatcattgatttgtatt
aaaacagccaacccggtaatctttagttttcaccccggggggcaaaaatgcagcgcggca
gccgccaaggtaatgcttgacgcggcggtggcggccggggcaccggaaaactgcattggc
tggattgaggaatcctccctggaggccacccgctacctgatgaaccaccccggcgtgcag
ttgattttggccaccgggggtgccgggctggtgcaggctgcctacagtacaggcaagccg
gccctgggggtggggccgggcaatgtaccctgttatattgaaaaaacagcgcatattaag
cgggcggtaaccgatctgattttaagcaaaaccttcgataatggtctgatttgcgcctct
gaacagtcggtgattatcgaccgggaggtttttcaagaagttaccgggctgatgaaaacc
tacggctgttatttcctgaatgatcaagagacggccaagcttgaagctatggcggtaaag
ggggaggactgtgccttaaactccgccattgtgggacagaccgcctatgatatcgcgcaa
atggcgggatttgaggtgccccgggctgccaaggtgctggtggcaccccagcagggggtg
gggcctggatatcccctgtccatggaaaagttgagccccatactggcctgttaccaggtg
gacgattacagggagggcatcagtcgctgtgaagaaatcgtgggctttggcggcctggga
cactcggctgtgctgcacactgaggataaagacgtggtggccgaattttcccggcgcatg
cgcacagggcggattatcattaattccccggccactcatggagccatcggggatttgtac
aatgtcaacataccctccctgaccctgggctgtggatccatgggccataacgccaccacc
tccaatgtcagcgtcgataatttaattaatattaagcgggttacagggcgtcgaaataag
ctgcagtggttcaaagtgccggagcgtatttatttcacgtcaggttcggtacagtatttg
caaaaaatgcagggtatagccagggtcattattgtcaccgacccgggtatagttaagctg
ggttttgttgataaagtggtataccatctgaacaaacgtaataaccaggtcagtgtggaa
atattctcggacgtggagcccgatccgtcagtggaaacggtacaaaagggtgtagagata
atgaagcaattccgcccggataccattattgctctggggggcggctcgcccattgatgct
gccaaggccatgtggctgttttacgagcatcccgaggtggagtttgactttctgcgcttg
aagttcttggatatccgcaaacgcacttataaatatcccaagctggggcggcaggcccag
tttgtggccatacccaccaccagtggcacgggttccgaggttagcgcttttgctgtaatt
acccacaagggccaggatatcaagtatcccctggcggattatgaactgaccccggatgtg
gccataattgacccggattttgttggtacgctgcccccggcggttattgcggacaccggt
ttggatgtgctgacccatgccctggaggcctatgtgtcggtgatggcctcggattacacc
gatgccatggccatgaaggctactgagttggtgttcaagtatttgcccgccagttacggt
gaaaaggataacttcacagcccggagcaaaatgcataatgcctcttgcatagcgggcatg
gcttttaccaatgcctttttgggtgtctgccacagcctggctcacaagctgggcggcgag
tttcatattacccacggccgggccaacgctattatgctgccccacgttattagatacaac
gccgggatgcccagcaagtttacctctttcccacaatacgagtattttcaggctccggaa
aaataccggcagatggctgcttttctaggtatgccggcgggcaccgttgaggagggagtt
aacagcctcattgccggtgtggaaagattgcggtccggggtaggcataccggataccatt
gcccagtgtgatattgatgctgcgctgtttaagcaaaaggtgcccgagttggccgaaaaa
gcatttgttgaccagtctaccaccgctaacccgcgcatgcccctgatagaagaattggcc
gaaatattgctgcgcgcttacgacaacccgcacgcttaa

DBGET integrated database retrieval system