KEGG   Desulfotomaculum gibsoniae: Desgi_1638Help
Entry
Desgi_1638        CDS       T02657                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase Fpg
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
dgi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Desgi_1638
Enzymes [BR:dgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Desgi_1638
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Desgi_1638
DNA repair and recombination proteins [BR:dgi03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Desgi_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Zn_Tnp_IS1595 FbpA zinc-ribbons_6 Auto_anti-p27 Zn_ribbon_SprT DZR Lar_restr_allev zf-TFIIB
Motif
Other DBs
NCBI-ProteinID: AGL01110
UniProt: R4KKS0
Position
complement(1667517..1668347)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVKRTLDKKITGLTITGVDIAMPKIIREPDPENFAAQVTGRKITRLGRRGKY
LLLYLTGENVLIIHLRMTGRLVYTAPDEPLPKHTHVIFKLSDGNELRFNDIRQFGRLLLT
PKKDLNKVKGLKDLGPEPLEREFSRDFLRRELKRKRTRIKSLLLDQTFIAGLGNIYVDEA
LHRARLHPMRIASSLTPREVANLYHSIVEVLQEGIQNRGTSFRDYVDGDGRKGNYQELLR
VYNREGEPCPHCGTAITRIKVSGRSSYFCPACQREQ
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaagttgaaacagtcaaaagaacactggacaaaaaaataacgggg
cttaccataaccggtgtggatatagccatgcccaaaattatccgggaacccgatccggag
aattttgccgcgcaagtcacgggccgcaaaattacccggctgggacggcgcggcaagtac
ctgctgctgtatctaaccggtgaaaatgtacttattatccacctgcgcatgaccgggcgc
ctggtttataccgcgcctgacgagccgctgcccaaacatacccatgtaatctttaagctc
agtgacggcaatgaactgcgctttaacgacatacggcagttcgggcgtttgctgctgacc
cccaaaaaggacttaaacaaggtcaagggtctaaaagatttgggaccggagcctttagaa
cgggagttctccagggattttttgcgccgggagctaaaacgcaaacggacgcgcattaag
tcactgctgctggatcaaacgtttattgccggcctgggtaatatttatgttgatgaggcc
ttgcaccgggcccgtctgcatcccatgcgcatagccagctcgcttactccccgggaggtg
gccaacctgtatcactccatcgttgaggtgctgcaagagggcatccaaaaccgtggtaca
tcgttcagggattacgtggacggtgacggccgcaaaggtaactaccaggagttgctgcgg
gtttacaaccgcgagggcgaaccatgtccccactgcggcacagcaatcacccgcatcaaa
gtaagcgggcgcagctcgtacttctgccccgcctgccagcgggaacaataa

DBGET integrated database retrieval system