KEGG   Desulfotomaculum gibsoniae: Desgi_3032Help
Entry
Desgi_3032        CDS       T02657                                 

Definition
peptidase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desgi_3032
Enzymes [BR:dgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Desgi_3032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3093189..3094304
Genome map
AA seq 371 aa AA seqDB search
MAVNINDALRNEIVDLLRELIPVAGVTGFEDAIREKIINLLEPTGLQMSTDHMGNLYGTV
PGKKSGGTKLPRVMICAHMDEVGYVVSNIDAQGFIYLYPLGGIPEYLGPGEWVSLHTGSG
VVQGSVGMHPPHLPVTGQREIFVDVGAQNKAEVLQMGISTGTPVTFTHSFYQLNENRVMG
RCLDDRMGCAVLIALLNTLSTDPVEAEVTGVFSSTEEHGMPPGSGPSYVHGSRGALVAAM
KIKPDFAVVVDSMVCSDIPGIPTHLRQISLGQGVALRLVDDLAIMRPPMRTFLKETAKSA
GVTIQEGISRSYTDTSAIQLFDIPVATLGIPLRYAHAPAQIADINDLVQTTQFMKVIAQK
AGQYLFNFNKK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttggcggttaatattaacgatgcgctgagaaatgaaattgtcgatctgctgcgagagctg
atacccgtagcgggtgttacggggtttgaggatgcgatcagggaaaaaattataaatttg
ctggagcccaccggcctgcagatgagcactgatcatatgggcaacctttacggcactgtg
ccgggcaaaaaaagcggcggcaccaaacttcccagggtaatgatttgcgctcacatggat
gaagtaggttatgtggtcagcaacattgacgcccaggggttcatttatctttatccattg
ggcggcatacctgaatacttaggaccgggtgaatgggtgtcgctgcataccggttcagga
gtcgtccaggggagtgtaggcatgcacccgcctcacctgccggtgacgggacagcgggag
attttcgtggacgtgggagcgcaaaacaaggctgaggtactgcaaatggggatttctacc
ggcacgccggtaacctttacccatagtttttaccaactcaacgaaaaccgggtgatgggc
aggtgtcttgatgaccggatgggctgcgccgttctgatagcccttttaaacacgttgtct
actgaccctgttgaggccgaagtcaccggggtgttctccagcactgaagagcacggcatg
ccgccaggcagcggtccatcctacgtgcacgggtcccgcggtgctctggttgcagccatg
aaaataaaaccggactttgccgtggtggtggacagcatggtatgcagcgatatacccggc
attcccacccaccttcgccaaatcagcctgggtcagggtgtggcgctgcgcttggtggac
gatctggctattatgcgcccgcccatgcgcacctttttaaaggaaacggctaaatcagcc
ggtgttaccatacaagaaggcatatcacgttcttataccgacacgtcggcaatccagctt
ttcgatatcccggtggcaaccctgggtatacctttgcgctatgcccatgctcccgcccaa
atagccgacattaatgatctggtgcaaacaacacaatttatgaaggtcattgcgcaaaaa
gccgggcaatatttgtttaattttaataaaaaataa

DBGET integrated database retrieval system