KEGG   Desulfotomaculum gibsoniae: Desgi_3287Help
Entry
Desgi_3287        CDS       T02657                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
dgi00330  Arginine and proline metabolism
dgi00332  Carbapenem biosynthesis
dgi01100  Metabolic pathways
dgi01130  Biosynthesis of antibiotics
dgi01230  Biosynthesis of amino acids
Module
dgi_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Desgi_3287
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Desgi_3287
Enzymes [BR:dgi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Desgi_3287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: AGL02633
UniProt: R4KHD7
Position
complement(3310083..3311198)
Genome map
AA seq 371 aa AA seqDB search
MEKRNYERMQRMVVKVGSSSLTYNTGKLNIGQFEALVRQLSDLHNRGLDVLLVTSGAVGA
GMGKLGFTQRPRTIPEKQAAAAVGQGLLLHMYEKIFAEYGLVVGQVLLTREDFADRRRFL
NARNTLQTMLNMHIIPVINENDTVAVDEIKLGDNDNLAAMVAALVDADILILLSDIEGLY
SDKPGTPGARIIPEIHEISDEIEALAGGVGSAVGTGGMATKIQAARIAMHSGMVTIIARA
SEPDVIRRLVAGEPLGTVFWPSVKLVNKKRWIAFSATVCGKIYIDEGAVTALRENGKSLL
PSGVIDVDGEFEMGNTVSVIAPDGREIARGIVNYAAAEIKQIKGKQTGEIALVLGYKDYD
EIIHRDNLALE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagagaaattacgagcggatgcagcggatggtggtaaaggttggttccagctca
ctcacttataacaccggcaagctgaatattggccaatttgaggcgctggtccggcaatta
tccgacctgcataaccgtggtctggatgtgttactggttacttccggagcggtgggggcc
ggtatggggaaactcggctttacgcagcggccccgcaccattcccgaaaaacaagccgcg
gctgcggtgggacaaggtttactgctgcacatgtacgaaaaaatatttgccgaatacggg
ctggtagtgggacaggtgctgctgaccagggaggactttgctgaccgccggcgcttttta
aatgcacgcaatactctgcaaactatgctgaacatgcatattataccggtgattaatgaa
aacgacaccgtcgcggtggatgaaatcaaacttggcgataacgacaacctggcggctatg
gttgccgccctggtggatgcagatattttaatactactttcggatatagaagggttatac
agtgacaagcctggtacgcctggagcccggataatcccggaaatacacgagatcagcgat
gaaatagaagctctggccggcggtgtgggctcagcagtaggaacaggtggcatggctact
aaaattcaggctgcccgcattgccatgcactctggaatggtaaccataatagctcgcgct
tctgaacctgatgtgattaggcggttggtggccggtgagccgttgggcactgtcttttgg
ccttcagttaaactggttaataaaaaaagatggattgccttcagcgccactgtttgcggc
aagatatacatagatgagggggcggttacggcgctccgggaaaatggcaaaagcctgctg
ccctcgggcgttatcgatgttgatggtgaatttgaaatgggcaatacggtaagtgttatc
gccccggacggtagggaaatcgcacgggggatagtaaactatgctgctgcggaaataaaa
cagatcaaaggcaagcaaaccggcgaaatagccctggtgctggggtacaaggactatgac
gaaatcatccaccgggacaacctggcgctggagtga

DBGET integrated database retrieval system