KEGG   Desulfotomaculum gibsoniae: Desgi_3384Help
Entry
Desgi_3384        CDS       T02657                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Desgi_3384
Enzymes [BR:dgi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Desgi_3384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3408484..3410538
Genome map
AA seq 684 aa AA seqDB search
MDWQNDALRELAQIYGLQTTYRDAGGQRRQVSEQALLATLQALGAPLAGPDDVPDALRQS
HLEQWQRCCEPVTVAWEGQPVHIELRLPANLSNSRVNCRLKIERGTTKEWTFDLAQLPPV
AGTTIESVDYQVKQLPLPGKMPQGYHQCFITMPGFKCQSMIIAAPPKAYLPPDETTKRLW
GVFMPLYALRSKHSWAAGDINDLEQLLRWTQGLGGNTVGTLPLLAAFLDEPFSPSPYSPA
SRLFWNEFYLNLNAIPELKLCQPARDLLKSQALQKEIAALHNAPLVDYRWGMAVKRQILE
LLARYCSGTPGREAALQSWISANPAARDYARFRATMEKQHAIWSRWPQRMYNGVLQAGNY
APSTERYHLYVQWLAHEQIDALSKQARKRGPGLYLDLPLGVHRAGYEVWRERKAFAREAD
CGAPPDQLNTAGQNWEFPPLHPEGIRQQGYRYYIATLRHHMQHAGILRLDHVMGLHRLFW
IPRGLAARDGVYVKYRAEEFYAILALESHRHQTLLVGEDLGTVSPHVRASMDRHKIYRMH
ILPFEIRQIPSQGPHPPPARSLAALNTHDMPPFAAYWSQEDRRNRLGISRFLFRKGWLAA
PTSNQRKVFKGCLKHLAASRARVLLVNMEDLWLETAPQNIPGTTQEYPNWRRKARRDIEE
FTRLPGVLKLLQEINRLRKGRVLK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
ttggattggcagaatgacgcattgcgtgagctagcccaaatatacgggctgcaaacgacc
taccgggatgccggcgggcaacgccgccaggtatcggaacaagcgctgctggccacgctg
caggcgctgggtgccccgttggccggaccggatgatgtgccggacgctctgcggcagagt
catctagagcagtggcaacgctgctgtgaaccagtaacggtggcctgggaaggacagccc
gtgcatattgagcttcgcctaccagcgaatttgagtaatagccgggttaattgccggcta
aagatagaaaggggcaccacaaaggaatggacgtttgacctggcacagctgcccccggtg
gcaggaaccacgatagaaagcgttgattaccaggtcaagcaactacctttgcctggcaaa
atgccccaaggttatcatcaatgctttataaccatgccgggctttaaatgtcagtcaatg
atcattgccgcgccgccaaaagcctatttacccccggacgaaaccacgaaacgcctgtgg
ggggttttcatgcccctttatgcattacgctccaagcatagttgggcggccggggacatt
aacgatctggagcaattgctgcgctggacccagggactgggtggcaacacggtgggcaca
ctgccgctgttggccgcctttctggatgagcccttctcccctagtccttactcgcctgcc
agccgcctgttttggaatgagttttaccttaatttaaacgctattccggagcttaaacta
tgccagccggcacgggatttacttaaatcacaagccttgcaaaaagaaatcgccgcattg
cacaacgctcccctggtggattaccgctggggtatggcagtaaaacgccaaattcttgag
ctgctggcccggtactgctctggaacaccaggtagggaagccgcgctgcaaagctggata
tccgctaacccggcggcccgggattacgcccgttttcgtgccaccatggaaaaacagcac
gctatttggtcaaggtggccccaacgaatgtataatggcgtactccaagcagggaattac
gcaccatctacagaacgctaccacttatatgtacagtggctggcccacgaacaaattgac
gccctgtccaagcaggcccggaaacggggacccgggctgtatctcgatttgcctctgggg
gtacaccgcgcgggatatgaagtttggcgtgagcgaaaggcttttgccagagaggcggat
tgcggtgcaccaccggatcaactaaataccgcggggcaaaactgggaattcccaccgctg
caccccgaagggatcagacaacaggggtaccggtactacatcgcaactttgcgccatcac
atgcagcacgccggcatactacgcctggaccatgtaatgggcttacaccgcctattctgg
ataccccggggtttagcggcccgggacggagtgtacgtcaaataccgggccgaggaattt
tacgctatattagccctggaatcacatcgccaccagacgcttcttgtaggcgaggatctg
ggcaccgtctcaccgcacgtccgggcatccatggaccggcacaagatttataggatgcat
attctgccttttgagatcaggcagatacccagccagggcccacatccccccccggcccgc
tccctggccgcgctaaacacccacgatatgccacccttcgcagcttactggagtcaggaa
gaccgacgcaaccgcctgggaatatcccgttttttatttcgcaaaggctggctggcggct
cccaccagcaatcaacgcaaggtttttaaggggtgtttaaaacacctggccgcaagccgg
gcgcgggtactgttggtaaatatggaagatctatggctggaaacggcaccccagaacatc
cccggcaccacgcaagaatatcccaactggcggcgcaaggcccgccgggatatcgaagaa
ttcacccggctacccggagtgttaaaattattgcaagagattaaccggttaaggaagggt
agggtattaaaataa

DBGET integrated database retrieval system