KEGG   Desulfotomaculum gibsoniae: Desgi_4274Help
Entry
Desgi_4274        CDS       T02657                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Desgi_4274
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Desgi_4274
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Desgi_4274
Enzymes [BR:dgi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Desgi_4274
Exosome [BR:dgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desgi_4274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4358806..4360173
Genome map
AA seq 455 aa AA seqDB search
MKFYNLKKKATSLILSGSLLLTAAMPNAALAKDLVAQDKPLAKNIIVMISDGCGYNQLDT
ASMYQYGKTGGQVYEHFPVKYGMSTYSEGSYDPNLAWGSFDYVKSGATDSAAAATAMSTG
VKTYDAAIGVGIDGTSLKHVAERAEELGKATGVVTSVQLSHATPAGFVAHNASRNDYSGI
ANEMIKDSATDVIMGAGNPWFDNNGQQITAPNTFKYVGGEATWQGLVDGTLEVADANGDG
IADPWTLIQTKDEFIDLIDDKTPERVIGVPQVFTTLQQGRSGDDKAEPYAVPMNQNAPTL
AEMTKGALNVLDNDSDGFFLMIEGGAIDWAGHANQSGRVIEEEIDFNKSVEAVVDWVKEN
SNWGETLLIVTGDHETGYLTGPGSDPTWEPLVNNNAGNLPGMQWNSGSHTNSLIPFFAKG
DAARLFKSYADETDPVRGKYIDNIEIAKVIFEIMK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttataatttaaaaaagaaagcaacttccttgattctatctggcagtttactt
ttaaccgctgcaatgcccaacgcagccctggctaaagacctggtggcgcaggataaacct
ctggcaaaaaatattattgtaatgatcagtgatggatgtggttataatcaacttgacacc
gccagcatgtatcaatacggcaaaactggcggtcaggtgtacgagcacttcccggttaaa
tacggtatgagcacttactctgaaggttcatatgatcctaacctggcttggggcagcttt
gattatgtaaaaagcggcgctactgattcagcggctgctgccacggccatgtccaccggc
gtaaaaacttacgatgcggctatcggcgtaggcatcgatggtacttctttaaaacacgtt
gccgagcgggcggaagaattgggcaaagctaccggcgtagtcaccagtgtccaattaagt
cacgctacccctgctggttttgtggcacataatgctagtcgtaatgattattccggaatt
gctaacgaaatgatcaaagatagtgcaaccgatgttattatgggtgctggaaacccatgg
tttgacaataacgggcaacagataactgctcctaatacctttaaatatgttggcggagaa
gcgacctggcaaggtttggtagatgggacccttgaagttgccgatgctaacggtgacggt
attgctgacccctggacactaatacaaacaaaagatgagtttattgatttaattgatgat
aaaacccctgagcgagtcattggcgtaccccaagtctttacaacacttcaacaaggccgt
agtggcgatgacaaagctgaaccttacgccgtaccaatgaaccaaaatgcacccaccctg
gctgaaatgactaagggtgccttaaacgtgctggacaatgactctgacggtttcttcctg
atgatagaaggcggagcgattgactgggccggccatgccaaccagtctggccgtgttatt
gaagaagaaattgattttaataaatctgtggaagcagtggtagattgggttaaagagaac
agtaattggggtgaaaccttattgatagtaaccggggaccatgaaaccggctaccttacc
ggccctggatcagaccctacctgggagcccctggtaaacaataacgccggaaacttaccg
ggtatgcaatggaacagcggcagtcataccaacagtctaattccgttctttgccaagggt
gatgctgccaggttatttaagagttatgcagatgaaactgaccctgtccgcggcaaatat
attgacaacattgaaatagctaaggttatatttgagattatgaaatag

DBGET integrated database retrieval system