KEGG   Desulfotomaculum gibsoniae: Desgi_4597Help
Entry
Desgi_4597        CDS       T02657                                 

Definition
(GenBank) glutamate dehydrogenase/leucine dehydrogenase
  KO
K00260  glutamate dehydrogenase [EC:1.4.1.2]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
dgi00220  Arginine biosynthesis
dgi00250  Alanine, aspartate and glutamate metabolism
dgi00430  Taurine and hypotaurine metabolism
dgi00910  Nitrogen metabolism
dgi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Desgi_4597
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desgi_4597
   00220 Arginine biosynthesis
    Desgi_4597
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Desgi_4597
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     Desgi_4597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C AdoHcyase_NAD DUF4771
Motif
Other DBs
NCBI-ProteinID: AGL03824
UniProt: R4KMB2
Position
complement(4685903..4687198)
Genome map
AA seq 431 aa AA seqDB search
MTKKINNYEIVKGLIDATVKKMSLNRSVYNILSEPQNVVEVAIPVQMDDGSINVIKGYRS
QHNNALGPYKGGIRFHQDVDIDEVKALSAWMTLKCALLNVPFGGSKGGVVVDPRELSPGE
LERLSRGYIRAISPILGMDIDIPAPDVGTDGRVMGWMLDEFSRYKNYGEFGMITGKPIIV
GGSLGRVEATSRGAMFIIREAARAMGINMKGAEVVVQGFGNVGGNAVKILHEVGCRILAV
SDVYGGVYNPKGLDVPSLQEYYAQNGTLKDFPGSQNIGNKELLTLKCDILVPAAVENQIT
GQNAANINAKIVAEAANGPTTPDADKILAERKILVLPDVLTNAGGVTVSYFEWVQNRYGY
YWSEDEVNDRLERKMVEAFNTIYSLYRNRKDVDMRGAAYMVAIERIYEAMRVRGWLGHQV
QPEVKREVKFA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgactaagaaaattaataactatgaaatcgttaaaggactaattgatgctactgtaaag
aaaatgagtttaaataggtcggtatataacattctcagtgaacctcaaaatgtggtggaa
gtagctattccggtgcaaatggatgacggttcgatcaatgttattaaaggttatcgttct
cagcataataatgcccttggcccgtataaagggggtatccggttccatcaagacgtggat
atagatgaggtcaaagctctatcagcttggatgaccctaaagtgcgcgctgctcaatgtt
ccgttcggcggcagcaagggcggtgtggtggtggatccgcgggaactttcccccggagag
ctggaaaggctgagccgtggctatatacgtgccatatctcctattctgggtatggatatt
gatattcctgctcccgatgtgggtactgacggcagggtcatgggctggatgctcgatgaa
ttcagccgctacaagaattatggtgaatttggtatgatcaccggtaagcctatcattgta
ggagggtcccttggccgggttgaggccacttcccgcggtgctatgtttattatccgtgag
gccgcaagggccatgggcattaatatgaagggtgcggaagttgtggtgcaggggttcggc
aatgtgggcggaaatgccgtaaaaatactgcacgaggtgggctgtcgcattttggcggta
agtgacgtatacggtggcgtgtataaccccaaaggtttggatgtcccgtccctgcaagaa
tactatgcacaaaatggtactttgaaagatttccctggaagccagaacatcggcaataaa
gaactgcttacactaaagtgcgacatactggtgccggcggccgtagaaaatcaaattacc
ggacaaaatgccgctaatattaacgctaaaattgttgctgaagcagccaacggacccaca
acaccggatgcggacaaaattttggctgaaaggaaaattcttgtgctgcccgatgtgttg
accaacgctggtggtgtaactgtttcttactttgagtgggtgcaaaaccgttatggttat
tactggagtgaggatgaagttaacgataggttggaaagaaagatggtagaagcttttaat
actatttattcactataccggaaccgaaaagatgtggatatgcggggtgcggcatatatg
gtggccatcgaacgtatctatgaggccatgcgtgtcagaggctggctgggacaccaggtg
caacccgaagtgaagcgggaagtaaaatttgcttaa

DBGET integrated database retrieval system