KEGG   Desulfotomaculum gibsoniae: Desgi_4597Help
Entry
Desgi_4597        CDS       T02657                                 

Definition
glutamate dehydrogenase/leucine dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Desgi_4597
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desgi_4597
   00330 Arginine and proline metabolism
    Desgi_4597
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Desgi_4597
Enzymes [BR:dgi01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     Desgi_4597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4685903..4687198)
Genome map
AA seq 431 aa AA seqDB search
MTKKINNYEIVKGLIDATVKKMSLNRSVYNILSEPQNVVEVAIPVQMDDGSINVIKGYRS
QHNNALGPYKGGIRFHQDVDIDEVKALSAWMTLKCALLNVPFGGSKGGVVVDPRELSPGE
LERLSRGYIRAISPILGMDIDIPAPDVGTDGRVMGWMLDEFSRYKNYGEFGMITGKPIIV
GGSLGRVEATSRGAMFIIREAARAMGINMKGAEVVVQGFGNVGGNAVKILHEVGCRILAV
SDVYGGVYNPKGLDVPSLQEYYAQNGTLKDFPGSQNIGNKELLTLKCDILVPAAVENQIT
GQNAANINAKIVAEAANGPTTPDADKILAERKILVLPDVLTNAGGVTVSYFEWVQNRYGY
YWSEDEVNDRLERKMVEAFNTIYSLYRNRKDVDMRGAAYMVAIERIYEAMRVRGWLGHQV
QPEVKREVKFA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgactaagaaaattaataactatgaaatcgttaaaggactaattgatgctactgtaaag
aaaatgagtttaaataggtcggtatataacattctcagtgaacctcaaaatgtggtggaa
gtagctattccggtgcaaatggatgacggttcgatcaatgttattaaaggttatcgttct
cagcataataatgcccttggcccgtataaagggggtatccggttccatcaagacgtggat
atagatgaggtcaaagctctatcagcttggatgaccctaaagtgcgcgctgctcaatgtt
ccgttcggcggcagcaagggcggtgtggtggtggatccgcgggaactttcccccggagag
ctggaaaggctgagccgtggctatatacgtgccatatctcctattctgggtatggatatt
gatattcctgctcccgatgtgggtactgacggcagggtcatgggctggatgctcgatgaa
ttcagccgctacaagaattatggtgaatttggtatgatcaccggtaagcctatcattgta
ggagggtcccttggccgggttgaggccacttcccgcggtgctatgtttattatccgtgag
gccgcaagggccatgggcattaatatgaagggtgcggaagttgtggtgcaggggttcggc
aatgtgggcggaaatgccgtaaaaatactgcacgaggtgggctgtcgcattttggcggta
agtgacgtatacggtggcgtgtataaccccaaaggtttggatgtcccgtccctgcaagaa
tactatgcacaaaatggtactttgaaagatttccctggaagccagaacatcggcaataaa
gaactgcttacactaaagtgcgacatactggtgccggcggccgtagaaaatcaaattacc
ggacaaaatgccgctaatattaacgctaaaattgttgctgaagcagccaacggacccaca
acaccggatgcggacaaaattttggctgaaaggaaaattcttgtgctgcccgatgtgttg
accaacgctggtggtgtaactgtttcttactttgagtgggtgcaaaaccgttatggttat
tactggagtgaggatgaagttaacgataggttggaaagaaagatggtagaagcttttaat
actatttattcactataccggaaccgaaaagatgtggatatgcggggtgcggcatatatg
gtggccatcgaacgtatctatgaggccatgcgtgtcagaggctggctgggacaccaggtg
caacccgaagtgaagcgggaagtaaaatttgcttaa

DBGET integrated database retrieval system