KEGG   Desulfotomaculum gibsoniae: Desgi_4597Help
Entry
Desgi_4597        CDS       T02657                                 

Definition
glutamate dehydrogenase/leucine dehydrogenase
Orthology
K00260  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
dgi  Desulfotomaculum gibsoniae
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:dgi00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:dgi00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dgi00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:dgi00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4685903..4687198)
Genome map
AA seq 431 aa AA seqDB search
MTKKINNYEIVKGLIDATVKKMSLNRSVYNILSEPQNVVEVAIPVQMDDGSINVIKGYRS
QHNNALGPYKGGIRFHQDVDIDEVKALSAWMTLKCALLNVPFGGSKGGVVVDPRELSPGE
LERLSRGYIRAISPILGMDIDIPAPDVGTDGRVMGWMLDEFSRYKNYGEFGMITGKPIIV
GGSLGRVEATSRGAMFIIREAARAMGINMKGAEVVVQGFGNVGGNAVKILHEVGCRILAV
SDVYGGVYNPKGLDVPSLQEYYAQNGTLKDFPGSQNIGNKELLTLKCDILVPAAVENQIT
GQNAANINAKIVAEAANGPTTPDADKILAERKILVLPDVLTNAGGVTVSYFEWVQNRYGY
YWSEDEVNDRLERKMVEAFNTIYSLYRNRKDVDMRGAAYMVAIERIYEAMRVRGWLGHQV
QPEVKREVKFA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgactaagaaaattaataactatgaaatcgttaaaggactaattgatgctactgtaaag
aaaatgagtttaaataggtcggtatataacattctcagtgaacctcaaaatgtggtggaa
gtagctattccggtgcaaatggatgacggttcgatcaatgttattaaaggttatcgttct
cagcataataatgcccttggcccgtataaagggggtatccggttccatcaagacgtggat
atagatgaggtcaaagctctatcagcttggatgaccctaaagtgcgcgctgctcaatgtt
ccgttcggcggcagcaagggcggtgtggtggtggatccgcgggaactttcccccggagag
ctggaaaggctgagccgtggctatatacgtgccatatctcctattctgggtatggatatt
gatattcctgctcccgatgtgggtactgacggcagggtcatgggctggatgctcgatgaa
ttcagccgctacaagaattatggtgaatttggtatgatcaccggtaagcctatcattgta
ggagggtcccttggccgggttgaggccacttcccgcggtgctatgtttattatccgtgag
gccgcaagggccatgggcattaatatgaagggtgcggaagttgtggtgcaggggttcggc
aatgtgggcggaaatgccgtaaaaatactgcacgaggtgggctgtcgcattttggcggta
agtgacgtatacggtggcgtgtataaccccaaaggtttggatgtcccgtccctgcaagaa
tactatgcacaaaatggtactttgaaagatttccctggaagccagaacatcggcaataaa
gaactgcttacactaaagtgcgacatactggtgccggcggccgtagaaaatcaaattacc
ggacaaaatgccgctaatattaacgctaaaattgttgctgaagcagccaacggacccaca
acaccggatgcggacaaaattttggctgaaaggaaaattcttgtgctgcccgatgtgttg
accaacgctggtggtgtaactgtttcttactttgagtgggtgcaaaaccgttatggttat
tactggagtgaggatgaagttaacgataggttggaaagaaagatggtagaagcttttaat
actatttattcactataccggaaccgaaaagatgtggatatgcggggtgcggcatatatg
gtggccatcgaacgtatctatgaggccatgcgtgtcagaggctggctgggacaccaggtg
caacccgaagtgaagcgggaagtaaaatttgcttaa

DBGET integrated database retrieval system