KEGG   Deinococcus gobiensis: DGo_CA0034Help
Entry
DGo_CA0034        CDS       T01827                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00260  Glycine, serine and threonine metabolism
dgo00750  Vitamin B6 metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01230  Biosynthesis of amino acids
Module
dgo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DGo_CA0034 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DGo_CA0034 (thrC)
Enzymes [BR:dgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DGo_CA0034 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFD23961
UniProt: H8GS66
Position
complement(31667..33118)
Genome map
AA seq 483 aa AA seqDB search
MKYVSTRGAQNLGGFCDVLLLGLAPDGGLAMPGRIPTFGPEQIEALRGLSYPELAYAVMR
PFIDDIPETDLKRLLNDTYRAEVFGHPDIAPLTALGDSGLYLLELSNGPSLAFKDMAMQF
LGQVFEYVLERRGEHLNILGATSGDTGSAAEYAMLGKARVNVFMLSPHGRMSAFQQAQMF
SLREPNIFNIAVEGVFDDCQDLVKAVNADAGFKERYEIGAVNSINWARVLAQAVYYFKGY
FALGLPAGAEADFCVPSGNFGNVFAGYLARSMGLPIGQLVVASNENDVLHEFFTTGTYHV
RPAARVAVTSSPSMDIGKASNFERYLYLITGASLGTVSGAQTLAWWQDVGEGRPVNLAGT
PHWDAVRASRFVAGRSTHADRLNTIREVDAEFGRLIDPHTADGVFVARPHRRSGVPMVCL
ETALPIKFEDTVREAVGRSPERPTKFGGIEALERQFTVMDNDVEALKAFVAGRLDDRRRD
AQG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtctcgacgcgcggcgcgcagaacctgggcggcttttgcgacgtgctgctg
ctgggcctcgcgcccgacggcggcctcgccatgcctgggcgcattccgaccttcggcccg
gagcagatcgaggccctgcgcggcctgagctaccccgaactggcctacgcggtcatgcgg
cctttcatcgacgacattcccgagaccgacctgaagcggctgctgaacgatacctaccgc
gccgaggtgttcggccaccccgacatcgccccgctgaccgcgctgggcgactcggggctg
tacctgctggaactgtccaacggcccctcgctggccttcaaggacatggcgatgcagttt
ctggggcaggtattcgagtacgtgctggagcggcgcggcgaacacctgaacatcctgggg
gccacctcgggcgacaccggctcggccgccgagtacgccatgctgggcaaggcgcgcgtg
aacgtgttcatgctctcgccgcacggccgcatgagcgccttccagcaggcgcagatgttc
agcctgcgcgagcccaacatcttcaatatcgctgtcgagggcgtgttcgacgactgtcag
gacctcgtgaaggccgtcaacgccgacgccgggttcaaggagcgttacgagatcggagcc
gtcaactcgatcaactgggcgcgggtgctggcgcaggcggtgtactacttcaagggctat
ttcgcgctggggctgcccgccggggccgaggccgacttctgcgtgccctcgggcaacttc
ggcaacgtgttcgccgggtatctggcgcgcagcatgggcctgcccatcgggcaactggtg
gtcgccagcaacgagaacgacgtgctgcacgagttcttcacgaccggcacctaccacgtg
cggcccgccgcgcgcgtggccgtcacctccagccccagcatggacatcggcaaggccagc
aacttcgagcgctacctgtacctcatcacgggtgccagtctcggaacagtcagtggcgcg
cagaccctggcctggtggcaggacgtcggcgagggccgccccgtgaacctcgcgggcacg
ccgcactgggacgccgtgcgggccagccgtttcgtcgccgggcgcagcacccacgccgac
cgcctgaacacgatccgcgaggtggacgccgagttcggccgcctgattgacccgcatacc
gccgacggcgtgttcgtggcgcgcccgcaccggcgcagcggcgtaccgatggtctgcctg
gaaaccgcgctgcccatcaagttcgaggacacggtgcgcgaagcggtggggcgttcgccc
gagcgccccacgaaattcggcggcatcgaggcgctggagcggcagttcaccgtgatggac
aacgacgtggaggcgctgaaggccttcgtggcgggccggctggacgaccggcgccgggac
gcccagggctga

DBGET integrated database retrieval system