KEGG   Deinococcus gobiensis: DGo_CA0034Help
Entry
DGo_CA0034        CDS       T01827                                 

Gene name
thrC
Definition
Threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dgo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dgo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:dgo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(31667..33118)
Genome map
AA seq 483 aa AA seqDB search
MKYVSTRGAQNLGGFCDVLLLGLAPDGGLAMPGRIPTFGPEQIEALRGLSYPELAYAVMR
PFIDDIPETDLKRLLNDTYRAEVFGHPDIAPLTALGDSGLYLLELSNGPSLAFKDMAMQF
LGQVFEYVLERRGEHLNILGATSGDTGSAAEYAMLGKARVNVFMLSPHGRMSAFQQAQMF
SLREPNIFNIAVEGVFDDCQDLVKAVNADAGFKERYEIGAVNSINWARVLAQAVYYFKGY
FALGLPAGAEADFCVPSGNFGNVFAGYLARSMGLPIGQLVVASNENDVLHEFFTTGTYHV
RPAARVAVTSSPSMDIGKASNFERYLYLITGASLGTVSGAQTLAWWQDVGEGRPVNLAGT
PHWDAVRASRFVAGRSTHADRLNTIREVDAEFGRLIDPHTADGVFVARPHRRSGVPMVCL
ETALPIKFEDTVREAVGRSPERPTKFGGIEALERQFTVMDNDVEALKAFVAGRLDDRRRD
AQG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgtctcgacgcgcggcgcgcagaacctgggcggcttttgcgacgtgctgctg
ctgggcctcgcgcccgacggcggcctcgccatgcctgggcgcattccgaccttcggcccg
gagcagatcgaggccctgcgcggcctgagctaccccgaactggcctacgcggtcatgcgg
cctttcatcgacgacattcccgagaccgacctgaagcggctgctgaacgatacctaccgc
gccgaggtgttcggccaccccgacatcgccccgctgaccgcgctgggcgactcggggctg
tacctgctggaactgtccaacggcccctcgctggccttcaaggacatggcgatgcagttt
ctggggcaggtattcgagtacgtgctggagcggcgcggcgaacacctgaacatcctgggg
gccacctcgggcgacaccggctcggccgccgagtacgccatgctgggcaaggcgcgcgtg
aacgtgttcatgctctcgccgcacggccgcatgagcgccttccagcaggcgcagatgttc
agcctgcgcgagcccaacatcttcaatatcgctgtcgagggcgtgttcgacgactgtcag
gacctcgtgaaggccgtcaacgccgacgccgggttcaaggagcgttacgagatcggagcc
gtcaactcgatcaactgggcgcgggtgctggcgcaggcggtgtactacttcaagggctat
ttcgcgctggggctgcccgccggggccgaggccgacttctgcgtgccctcgggcaacttc
ggcaacgtgttcgccgggtatctggcgcgcagcatgggcctgcccatcgggcaactggtg
gtcgccagcaacgagaacgacgtgctgcacgagttcttcacgaccggcacctaccacgtg
cggcccgccgcgcgcgtggccgtcacctccagccccagcatggacatcggcaaggccagc
aacttcgagcgctacctgtacctcatcacgggtgccagtctcggaacagtcagtggcgcg
cagaccctggcctggtggcaggacgtcggcgagggccgccccgtgaacctcgcgggcacg
ccgcactgggacgccgtgcgggccagccgtttcgtcgccgggcgcagcacccacgccgac
cgcctgaacacgatccgcgaggtggacgccgagttcggccgcctgattgacccgcatacc
gccgacggcgtgttcgtggcgcgcccgcaccggcgcagcggcgtaccgatggtctgcctg
gaaaccgcgctgcccatcaagttcgaggacacggtgcgcgaagcggtggggcgttcgccc
gagcgccccacgaaattcggcggcatcgaggcgctggagcggcagttcaccgtgatggac
aacgacgtggaggcgctgaaggccttcgtggcgggccggctggacgaccggcgccgggac
gcccagggctga

DBGET integrated database retrieval system