KEGG   Deinococcus gobiensis: DGo_CA0118Help
Entry
DGo_CA0118        CDS       T01827                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dgo  Deinococcus gobiensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA0118 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA0118 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    DGo_CA0118 (sucB)
Enzymes [BR:dgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DGo_CA0118 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
124262..125539
Genome map
AA seq 425 aa AA seqDB search
MADIKVPVFSESVSEGTLLTWHKKPGEAVTRGEVLAEIETDKVVLEVTAQQDGVLTGIAK
QEGDTVLSEEVLGTVGEAGSAPAPAPAAAVSADPAAGPVSGEAPAQAAGNEATRRDDLSP
AVRKIVAEQNLDPAQIPATGPKGNITKADAVVAAQGGLTYQGPQDAAKPAGMQPAPAAQA
PQAAAPAPLPQGPRPEERVPMTRIRQRIAERLKDVQNTAALLTTFNEVNMQPAMDLRKKY
QDQFVAKHGVKLGFMSLFVRAATEALKAFPVVNASVDGKDVIYHGYYDIGIAVASDRGLV
VPILRDTEQLSLAAIEKGIAGYAQKAKSGKLTLDDMSGGTFSITNGGTFGSMMSTPIINA
PQSAILGMHNIIERPIAQKGQVVIAPMMYIALSYDHRIIDGKEAVQFLVMIKNLLEDPAR
MLLEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcggacatcaaggttcctgttttttccgagtcggtcagtgagggcaccctcctgacc
tggcacaagaagcccggtgaagccgtgacgcgcggcgaagtgctggccgaaatcgagacc
gacaaggtcgtgctggaagtcacggcccagcaagacggcgtcctgacgggcatcgccaag
caggaaggcgacacggtgctcagcgaggaagtgctgggcacggtgggcgaggcgggcagc
gccccggctccggcccctgccgccgccgtcagcgccgacccggccgccggccccgtctcg
ggcgaggccccggcgcaggctgccggcaacgaggcgacgcgccgcgacgacctctcgccc
gccgtgcgcaagatcgtggccgagcagaacctcgaccccgcccagattccggcgaccggc
cccaagggcaacatcaccaaggccgacgccgtggtggcggcccagggtggcctgacctac
cagggcccgcaggacgccgccaagccggccgggatgcagcccgcccccgccgcccaggcc
ccgcaggccgccgcgcccgcgccgctgccccagggcccccgccccgaggagcgtgtgccc
atgacgcgcatccgccagcgcatcgccgagcgcctcaaggacgtgcagaacaccgccgcc
ctgctgaccaccttcaacgaggtgaacatgcagcccgcgatggacctgcgcaagaagtac
caggaccagttcgtggccaagcacggcgtcaagctcgggttcatgagcctgttcgtgcgc
gcggcgaccgaggccctcaaggccttcccggtggtcaacgcgagcgtggacggcaaggac
gtcatctaccacggctactacgacatcggcatcgcggtcgccagtgaccgaggcctggtc
gtgccgatcctgcgcgacaccgagcagctcagcctcgcggccatcgagaagggcatcgcc
ggctacgcccagaaggccaagagcggcaagctcaccctcgacgacatgtcgggcggcacg
ttcagcatcaccaacggcggcaccttcggctcgatgatgagcacccccatcatcaacgcg
ccgcagagcgccatcctgggtatgcacaacatcatcgagcgccccatcgcccagaagggt
caggtcgtgatcgccccgatgatgtacatcgccctgagctacgaccaccgcatcatcgac
ggcaaggaagcggtgcagttcctcgtgatgatcaagaacctgctcgaagacccggcgcgc
atgctgctggagctgtaa

DBGET integrated database retrieval system