KEGG   Deinococcus gobiensis: DGo_CA0179Help
Entry
DGo_CA0179        CDS       T01827                                 

Gene name
murE
Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
dgo  Deinococcus gobiensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:dgo00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dgo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183385..184848)
Genome map
AA seq 487 aa AA seqDB search
MRLPDLAAALSLPASDLPNVEVSGATHNADWVGPGSVFVAIRGARFDGHAFMDKARGAGA
VAVLGEGLPDGMTAPLPYLRVPDARAALADAAAALAGHPSRALKVVGVTGTDGKTTTSWL
ARHLLRAAGIPTGLLSTVGYELPDGELRHFPAHFTTPEAPEVQATLAEMVRVGAGAAVLE
ASSHALALDRVRGVDWDVAVWTHLSSEHLDFHGTLENYFADKKKLVERAPFAVLNVDDPW
TAELRGVAPEETTYSAENQHADWRATGVEEGPGGLSFDVASPAGEFRARLPMIGRFNVAN
ALAAMAAAHRLGAAPEALVAGLASFAGVPGRMELVPGPGGGPRVIVDFAHTPPSLEKALG
MLRATTPGRLWVLVGSAGGRRDPSKRAPLGEVATRLADHAVLTEEDCRDTPIADILAEME
RGAREAGRANFTSIPDRREAIAHVIAQAAPGDTVLLAGKGPEDTLERAAETLPWDEVGEA
RAALQRR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccgacctcgccgccgccctcagcctgcccgcctccgacctgccgaatgtg
gaggtgagcggcgcgacccacaacgccgactgggtggggcccggctccgtgttcgtggcg
atccggggggcgcgtttcgacgggcacgccttcatggacaaggcgcgcggggcgggcgcg
gtcgccgtgctgggcgaggggttgcctgacggcatgaccgcgccgctgccctacctgcgc
gtgccggacgcccgcgccgcactggccgacgctgccgccgccctggccgggcaccccagc
cgcgccctgaaggtggtcggcgtgaccggcaccgacggcaagaccaccacgagctggctg
gcccgccacctgctgcgcgccgccggcatcccgaccggcctgctctcgacggtgggctac
gagctgcccgacggcgaactgcggcactttcccgcgcacttcaccacgcccgaggccccg
gaggtgcaggccaccctggccgagatggtgcgcgtgggcgcgggcgcggccgtgctggag
gcgagcagccacgccctggccctggaccgcgtgcgcggcgtggactgggacgtggccgtg
tggacgcacctgagcagcgagcacctggactttcacggcacgctggaaaactacttcgcg
gacaagaagaaactggtcgagcgcgcgcccttcgccgtcctgaacgtggacgacccctgg
accgccgagctgcgcggcgtggcccccgaggagacgacctacagcgccgagaaccagcac
gccgactggcgcgcgaccggggtcgaggaggggccgggcggcctgagcttcgacgtggcc
tcgcccgccggggagttccgggcccggctgcccatgatcgggcgcttcaacgtggcgaac
gccctggcggcgatggcggcggcgcaccggctgggcgcggccccggaggcgctcgtggcc
gggctggcgagtttcgcgggcgtgccgggccgcatggaactcgtgccgggacccggcggc
ggcccgcgcgtgatcgtggacttcgcgcacacgccgcccagcctggaaaaggccctgggc
atgctgcgggccaccacgccggggcggctgtgggtgctcgtcgggtcggcgggcgggcgg
cgcgatccctccaagcgcgcgccgctgggcgaggtggcgacccgcctggccgaccacgca
gtcctcaccgaggaagactgccgcgacacgccgatcgccgacatcctggccgagatggag
cgcggggcgcgggaggcgggccgggccaacttcacgtccattcccgaccgccgggaggcc
atcgcccacgtgatcgcgcaggcggcccccggcgacaccgtgctgctggcgggcaagggc
ccggaggacaccctggagcgcgccgccgagacgctgccctgggacgaggtgggcgaggcg
cgggcggccttgcagcggcgttga

DBGET integrated database retrieval system