KEGG   Deinococcus gobiensis: DGo_CA0205Help
Entry
DGo_CA0205        CDS       T01827                                 

Gene name
cel
Definition
(GenBank) M42 glutamyl aminopeptidase superfamily
Organism
dgo  Deinococcus gobiensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AFD24132
UniProt: H8GTI2
Position
211181..212206
Genome map
AA seq 341 aa AA seqDB search
MKLSDLPGVPGQEDAVRDFVLAELDGLADEVRVDALGNVIARRAASGEGPRGRVMVSAHM
DEIGFLVRYIDEKGYLRLQNLGGFDTRNLFARNVTVHTRGGALPGILTPAGRPVHIASPE
ERKKVPELREFFVDLGLDGDAVKAQVRVGDMVTLDQTARRVGQLVCGKAMDDRASVFLLL
ETLRALRGRPLRHDLYAVFSVQEEVGLRGAITAAYGVQPTVGIGLDVTLAVDTPGVGPDE
AVTRMGEGIGIKVYDSSMISTRTLVDEFWDLAQAREIPAQLEVLGQGGTDGAAIQRSREG
VPTLTLSLPTRYIHTIVESVHETDLRAGVDLLVAYLGEPSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtccgacctgcccggcgtgcccggacaggaggacgcggtgcgcgacttcgtg
ctcgcggaactggacggcctggccgacgaggtgcgggtggacgccctgggcaacgtgatc
gcccgccgtgccgcttcgggcgaggggccgcgcgggcgcgtgatggtctcggcccacatg
gacgagatcggctttctggtgcgctacatagacgagaagggctacctgcgcctccagaac
ctgggcggtttcgacacgcgcaacctgttcgcgcgcaacgtcaccgtgcatacgcgcggc
ggggcgctgcccggcatcctgaccccggcgggccgcccggtgcacatcgcctcgcctgag
gagcgcaagaaggtgcccgagctgcgcgagttcttcgtggacctcggcctggacggcgac
gcggtgaaggcccaggtgcgcgtgggcgacatggtcaccctcgaccagacggcccgccgg
gtggggcagctcgtgtgcggcaaggcgatggacgaccgcgccagcgtcttcctgctgctc
gaaacgctgcgtgccctgcgtggccgtcctttgcgccacgacctctacgcggtcttcagc
gtgcaggaagaggtcggcctgcggggtgccatcacggcggcctacggcgtgcagcccacg
gtgggtatcggcctggacgtgaccctggcggtggacacccccggcgtcggccccgacgag
gcggtcacgcgcatgggcgagggcatcggcatcaaggtgtacgactcctcgatgatctcg
acccgcaccctggtggacgagttctgggacctggcccaggcgcgcgagattccggcgcag
ctcgaagtgctgggccagggcggcaccgacggcgcggccatccagcgcagccgcgagggc
gtgcccaccctgaccctgagcctgccgacccgatacatccacaccatcgtcgagtcggtc
cacgaaaccgacctgcgcgcgggcgtggacctgctcgtggcgtatctgggcgagccttcg
gcctga

DBGET integrated database retrieval system