KEGG   Deinococcus gobiensis: DGo_CA0205Help
Entry
DGo_CA0205        CDS       T01827                                 

Gene name
cel
Definition
M42 glutamyl aminopeptidase superfamily
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dgo  Deinococcus gobiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGo_CA0205 (cel)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DGo_CA0205 (cel)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
211181..212206
Genome map
AA seq 341 aa AA seqDB search
MKLSDLPGVPGQEDAVRDFVLAELDGLADEVRVDALGNVIARRAASGEGPRGRVMVSAHM
DEIGFLVRYIDEKGYLRLQNLGGFDTRNLFARNVTVHTRGGALPGILTPAGRPVHIASPE
ERKKVPELREFFVDLGLDGDAVKAQVRVGDMVTLDQTARRVGQLVCGKAMDDRASVFLLL
ETLRALRGRPLRHDLYAVFSVQEEVGLRGAITAAYGVQPTVGIGLDVTLAVDTPGVGPDE
AVTRMGEGIGIKVYDSSMISTRTLVDEFWDLAQAREIPAQLEVLGQGGTDGAAIQRSREG
VPTLTLSLPTRYIHTIVESVHETDLRAGVDLLVAYLGEPSA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtccgacctgcccggcgtgcccggacaggaggacgcggtgcgcgacttcgtg
ctcgcggaactggacggcctggccgacgaggtgcgggtggacgccctgggcaacgtgatc
gcccgccgtgccgcttcgggcgaggggccgcgcgggcgcgtgatggtctcggcccacatg
gacgagatcggctttctggtgcgctacatagacgagaagggctacctgcgcctccagaac
ctgggcggtttcgacacgcgcaacctgttcgcgcgcaacgtcaccgtgcatacgcgcggc
ggggcgctgcccggcatcctgaccccggcgggccgcccggtgcacatcgcctcgcctgag
gagcgcaagaaggtgcccgagctgcgcgagttcttcgtggacctcggcctggacggcgac
gcggtgaaggcccaggtgcgcgtgggcgacatggtcaccctcgaccagacggcccgccgg
gtggggcagctcgtgtgcggcaaggcgatggacgaccgcgccagcgtcttcctgctgctc
gaaacgctgcgtgccctgcgtggccgtcctttgcgccacgacctctacgcggtcttcagc
gtgcaggaagaggtcggcctgcggggtgccatcacggcggcctacggcgtgcagcccacg
gtgggtatcggcctggacgtgaccctggcggtggacacccccggcgtcggccccgacgag
gcggtcacgcgcatgggcgagggcatcggcatcaaggtgtacgactcctcgatgatctcg
acccgcaccctggtggacgagttctgggacctggcccaggcgcgcgagattccggcgcag
ctcgaagtgctgggccagggcggcaccgacggcgcggccatccagcgcagccgcgagggc
gtgcccaccctgaccctgagcctgccgacccgatacatccacaccatcgtcgagtcggtc
cacgaaaccgacctgcgcgcgggcgtggacctgctcgtggcgtatctgggcgagccttcg
gcctga

DBGET integrated database retrieval system