KEGG   Deinococcus gobiensis: DGo_CA0257Help
Entry
DGo_CA0257        CDS       T01827                                 

Gene name
acs
Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dgo01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dgo00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dgo00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dgo00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dgo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267549..269465
Genome map
AA seq 638 aa AA seqDB search
MLHETRVIPPSAEFAARANLSREDYERLYRRSLDEPDQFWTEVAGELAWMKPWEQVLDWQ
EPHARWFVGGQTNVAYNALDRNVARGLGDRRAIVWEGEDGEVRTFTYAELLREVKKAANA
LEALGVQAGDRVTLYLPLIPEAAIAMLACARIGATHSVVFGGFSVSALADRIRDAESRLL
ITADAGYRRGALVNLKANADEAAALAPCLENILVVCRANCDAPMQPGRDVWWHDAVGAAG
EEHEAAALDSEHPLFVLYTSGSTGKPKGIVHTTGGYMVGTYLTTQSVFDLKPGDVYWCTA
DVGWVTGHSYSVYGPLLNGATVLMYEGAPNQPDWGRYWDLVQKHGVTILYTAPTAIRSFM
RQGDELPARYDLSSLRLLGSVGEPINPEAWMWYWRVIGGERCPVVDTWWQTETGSIMLTT
LPGAFAAKPGSAGLPMFGVDVAIMTRDGQELGPDEGGLLVVKRPWPSMLRTVYGDDARYR
KTYWGEIPHVYFAGDGARRDADGYVTVVGRVDDVLNVSGHRLGTMEIESALVSHPSVAEA
AVVGKPDAVKGEGVVAFVLPQLGQSVDPAALRAHVSREIGALARPDAIIVADALPKTRSG
KIMRRFLRQIAAGQEVQGDTSTLEDPSVLVRLAATPAV
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacgaaacccgcgtcattccgcccagtgccgagttcgccgcgcgggccaacctg
tcgcgcgaggactacgaacgcctgtaccgccgcagcctcgacgagcccgaccagttctgg
accgaggtcgcgggcgagctggcctggatgaagccctgggaacaggtcctcgactggcag
gagccgcacgcccgctggttcgtgggcggccagaccaacgtggcctacaacgccctggac
cgcaacgtggcgcgcggcctgggcgacaggcgcgcgatcgtctgggagggcgaggacggc
gaggtccggaccttcacctacgccgaactgctgcgcgaggtgaagaaggccgccaacgcg
ctggaggccctgggcgtgcaggccggggaccgcgtgaccctgtacctgcccctgattccc
gaggcggccattgccatgctggcctgcgcgcgcatcggggcgacgcacagcgtggtcttc
gggggcttctcggtctcggccctggccgaccgcatccgtgacgccgagagccggctgctc
atcaccgccgacgcgggctaccgccggggcgcgctggtcaacctcaaggccaacgccgac
gaggccgccgccctggccccctgcctggagaacatcctggtggtgtgccgcgcgaactgc
gacgcgcccatgcagccgggccgcgacgtgtggtggcacgacgccgtgggggccgccggc
gaggaacacgaggccgccgccctcgacagcgagcatcccctgttcgtcctgtacacctcg
ggcagcaccggcaagcccaagggcatcgtgcacaccacgggcggctacatggtgggcacc
tacctcaccacccagagcgtcttcgacctcaagccgggcgacgtgtactggtgcacggcc
gacgtgggctgggtcacggggcacagctacagcgtgtacggtcccctgctcaacggcgcc
acggtcctgatgtacgagggcgcgcccaaccagcccgactggggccgctactgggacctc
gtgcagaagcacggcgtgaccatcctgtacaccgccccgaccgccatccggtcgttcatg
cgccagggcgacgagctgcccgcccgctacgacctgagcagcctgcgcctgctggggtcg
gtgggcgagccgatcaaccccgaggcgtggatgtggtactggcgcgtcatcggcggcgag
cgctgcccggtcgtggacacctggtggcagaccgaaaccggctcgatcatgctgaccacg
ctgccgggggccttcgcggccaagccgggcagcgcaggtctgccgatgttcggggtggac
gtggcgatcatgacccgcgacggccaggaactcggcccggacgagggtgggctgctggtg
gtcaagcggccctggcccagcatgctgcgcacggtgtacggcgacgacgcccgctaccgg
aagacctactggggcgagattccgcacgtgtactttgcaggtgacggtgcgcggcgcgac
gccgacggctacgtgacggtggtgggccgcgtggacgacgtgctgaacgtctccgggcac
cgcctgggcaccatggagatcgagtcggcgctcgtgtcgcacccctcggtggccgaggcg
gcagtggtgggcaagcccgacgcggtcaagggcgagggcgtggtcgccttcgtgctgccg
cagctcgggcagagtgtggacccggcggcattgcgcgcgcacgtgagccgtgagatcggc
gcgctagcccgccccgacgcgatcatcgtggccgacgcgctgcccaagacccgcagcggc
aagatcatgcggcgtttcctgcgccagatcgccgccgggcaggaggtccagggcgatacg
agtaccctcgaagaccccagcgtgctggtccgcctcgcggccaccccggcggtctag

DBGET integrated database retrieval system