KEGG   Deinococcus gobiensis: DGo_CA0331Help
Entry
DGo_CA0331        CDS       T01827                                 

Gene name
chlI
Definition
Magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dgo  Deinococcus gobiensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DGo_CA0331 (chlI)
Enzymes [BR:dgo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DGo_CA0331 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
345587..346981
Genome map
AA seq 464 aa AA seqDB search
MGRQPFDGRVRLVQDEVRENLTRKLRAGEDLFPGVVGYDDTVIPQLVNALLARQNFILLG
LRGQAKSRILRAITGLLDDVVPVIDGVDMPDDPLNPVGAEGRHLLETHGLELPIRWLPRA
DRYVEKLATPDVTVADLVGDVDPIKAARLGTSLGDVRSMHFGLLPRANRGIFSVNELADL
APKVQVALFNILQEGDVQIKGYPIRLELDVMLVFSANPEDYTARGKIVTPLKDRIGSEIR
THYPTDVRLGMDITAQEAVRDEAVVVPDFIAELIEEIAFQAREDGRVDKLSGVSQRLPIS
LMEVASANAERRSLVSGDAPVVRVSDVYAGLPAITGKMELEYEGELKGADQVAKDVIRKA
AGAVYARNFGSADTRELEKWFEGGNVFRFPQSGDASAGVKATREVPGLSDFAAQVAGSSD
DAVRVSAAEFILEGLYGRKKLSRAEELYAAPEPETRQQRGGRWN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgtcagcccttcgacggccgagtccgactcgtgcaggacgaggtccgtgaaaac
ctgacccgcaagctgcgggcgggcgaggacctgttccccggcgtggtcggctacgacgac
accgtcattccccagctcgtcaacgcgctgctggcgcgccagaacttcatcctgctgggc
ctgcgcggtcaggccaagagccgcatcctgcgcgccatcaccggcctgctcgacgacgtg
gtgccggtcatcgacggcgtggacatgcccgacgatcccctgaacccggtgggcgccgag
ggccgccacctcctggagacgcacgggctggagctccccatccgctggctgccgcgcgcc
gaccgctacgtcgagaagctcgccacgcccgacgtgacggtggccgacctcgtgggcgac
gtggaccccatcaaggccgcccgcctgggcaccagcctgggcgacgtgcgctccatgcac
ttcgggctgctgccgcgcgccaaccggggcatcttctcggtgaacgaactggccgacctc
gcgcccaaggtgcaggtcgcgctgttcaacatccttcaggaaggcgacgtgcagatcaag
ggctacccgatccgcctcgaactcgacgtgatgctcgtcttctcggccaaccccgaggac
tacacggcgcgcggcaagatcgtcacgcccctcaaggaccgcatcggcagcgagatccgc
acccactaccccaccgacgtgcgcctgggcatggacatcaccgcccaggaagccgtgcgc
gacgaggcggtcgtggtcccggacttcatcgccgaactcatcgaggagatcgcctttcag
gcccgcgaggacggccgcgtggacaagctctcgggcgtgtcgcagaggttgcccatctcg
ctgatggaagtggcgagcgccaacgccgagcgccgctcgctcgtgtcgggcgacgccccg
gtcgtgcgcgtcagcgacgtgtacgccggcctgcccgcgatcacgggcaagatggaactg
gagtacgagggtgaactcaagggcgccgatcaggtcgccaaggacgtgatccgcaaggcg
gccggcgccgtgtacgcccgcaacttcggttcggccgacacccgcgagctggaaaagtgg
ttcgagggcggcaacgtcttccgctttccgcagagcggcgacgcctcggcgggggtcaag
gccacccgcgaggtgccgggcctgagcgacttcgccgcgcaggtggcgggcagcagcgac
gacgccgtgcgcgtctcggccgccgagttcattctcgaaggtctgtacggccgcaagaag
ctctcgcgcgccgaggaactgtacgccgcccccgaacccgaaacccgccagcagcgcggc
ggccgctggaactga

  All links  
No link information was found.   
DBGET integrated database retrieval system