KEGG   Deinococcus gobiensis: DGo_CA0541Help
Entry
DGo_CA0541        CDS       T01827                                 

Definition
Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA0541
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_CA0541
   00020 Citrate cycle (TCA cycle)
    DGo_CA0541
   00620 Pyruvate metabolism
    DGo_CA0541
Enzymes [BR:dgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     DGo_CA0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
559386..561206
Genome map
AA seq 606 aa AA seqDB search
MATELKLPDVGDNIEKGTVVTVLIKPGDTVAAGDPIIEIETDKAVVEVPASEGGTVEAVS
VNVGDTVAVGGVIATLGGGSAAPAAGAASGPAQAGQGGSNEQNTVESNDATVASDASTAQ
QVAQAQQDAQKVQAGEQPGSGAGSSGGSAPAPAAPQAPAQSSGGQDLTLPDVGDNIEKGT
VVTVLVNPGDTVTEGQPIIEIETDKAVVEVPASAGGTVQSVAVKVGDTVAVGGVILTLGG
GAASAPAQAPTPAAQPAASAAPAAPASGSAPAATPDTKPSQAPGAQRPYDTQTYDGRTVI
PAAPSVRRMAREIGVDIHEVHGSGIAGRISEEDVRRAAGTPSVQPAAPAAAPAAASAPAP
AAVQAAPLPNFEKWGTVRREDMSGIRKATVRSMTASTAIPMVTHFDKADVTEMEEVRKRF
GARVEKAGGKLTMTHILMKVVANALRKFPKFGASLDLTAEQVVYKDFVNIGVAVDTPVGL
LVPVIKDADRKSITELVLELSELAGRARDRKLKPDEMQGATFTISNLGGIGGHAFTPIVN
SPEVAILGVSRGGFEPVWDKAKGEFVPRNMLPLSLSYDHRLIDGADAARFVRFIAESLED
PFLISL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggccactgaactgaaactccccgacgtgggcgacaacattgagaagggcacggtcgtc
accgtgctgatcaagcccggcgacactgtcgcggccggcgacccgatcatcgagatcgag
accgataaggcggtcgtcgaggtgcccgccagcgagggcggcactgtcgaggccgtgagc
gtgaacgtgggtgacacggtcgcggtcggcggcgtgatcgccacgctgggcggcggctcg
gcggctccggcggccggcgcggccagtggcccggcccaggccggccagggcggcagcaac
gagcagaacacggtcgagtccaacgacgcgacggtggcctcggacgccagcaccgcccag
caggtcgcccaggcccagcaggacgcccagaaggtgcaggccggcgagcagccgggcagc
ggcgcgggcagcagcggcggcagcgccccggccccggcggcgccccaggccccggcccag
tccagcggcggccaggacctgaccctgcccgacgtgggtgacaacatcgagaaggggacg
gtcgtgacggtcctcgtgaaccccggcgacaccgtcaccgagggccagcccatcatcgag
atcgagaccgacaaggccgtggtcgaggtgcccgccagtgcgggcggcaccgtgcagagc
gtggccgtgaaggtgggcgacacggtcgccgtcggcggcgtgatcctgaccctgggcggc
ggcgcggcgagtgcgcctgcacaggcccccaccccggctgcccagcctgcggccagcgcg
gccccggctgctccggcgtccggctcggctccggcggcgacgcccgacaccaagcccagc
caggcccccggtgcccagcgtccctacgacacccagacctacgatggccgcaccgtgatc
ccggcggcccccagcgtgcgccgcatggcccgcgagattggcgtggacatccacgaggtc
cacggcagcggcatcgccgggcgtatcagcgaggaagacgtgcgccgcgccgccggcacg
cccagcgtgcagcccgccgccccggctgcggctccggctgctgccagcgcgcccgctccg
gccgccgtgcaggccgcgccgctgcccaacttcgagaagtggggcacggtccggcgcgag
gacatgagcggcatccgcaaggccaccgtgcgttccatgacggccagcaccgccattccg
atggtcacgcacttcgacaaggccgacgtgaccgagatggaagaggtccgcaagcgcttc
ggcgcgcgggtcgagaaggcgggcggcaagctcaccatgacccacatcctgatgaaggtc
gtggcgaacgccctgcgcaagttccccaagttcggcgcctcgctggacctcactgccgag
caggtcgtctacaaggacttcgtgaacatcggcgtggcggtggacaccccggtcgggctg
ctcgtgccggtcatcaaggacgccgaccgcaagagcatcaccgaactggtcctcgaactc
tcggaactcgcgggccgcgcgcgcgaccgcaagctcaagcccgacgagatgcagggcgcc
accttcaccatctccaacctcgggggcatcggcggccacgccttcacgcccatcgtgaac
agccccgaggtcgccatcctgggcgtgtcgcgcggcggcttcgagccggtgtgggacaag
gccaagggcgagttcgtgccgcgcaacatgctgcccctctcgctgtcctacgaccaccgc
ctgatcgacggggccgacgccgcgcgtttcgtgcgctttattgccgagtcgctggaagac
cccttcctcatctcgctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system