KEGG   Deinococcus gobiensis: DGo_CA0585Help
Entry
DGo_CA0585        CDS       T01827                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dgo  Deinococcus gobiensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dgo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:dgo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:dgo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(618905..620653)
Genome map
AA seq 582 aa AA seqDB search
MKAMKYLLSLALLVCSAASAADLKVYPYDGAKFVPGQRFDLRIEAENVQNFQGAAVTLDG
QPVAGLVQTTTKPTSVEWTLRGQSLPTGLHELSVRYRDAAGEATKTARWYVVPAAAARAK
NVILFIGDGMGWNTVNAARLIAHPYNPTNGTPTGQLAMMSGLSGMASVTTSSFDSALADS
ANTASSIATGQKIQVNALNVYPDNTADTLDNPRVETITAMLRRSMGKGVGIVTSAFGVDA
TPAAFASYTRRRGDYSAIADQYFKGDVQPDVLLLGGSRDFIPSTAPGSRRKDTTDWITDS
QKQGYTFVSSRTELNAANTNKLFGLFNIDNIPSYLDRAQYKTTEALGDFKDMPYLWDSTK
KAVETLEKNPNGFFLMVEAGMVDKYEHPLDWQRGVWDVLELDKAVEWAKDYAKTHPDTLI
LVTADHAHSLSVYGGYDATKGPGKREAVGVYESAGFPTYGDKRDANGLPLPETARTYAVG
FAAVPDYCETYLGRRIFLDPTVSNGKTGAEAGYLPNPKICEEGGVTRTGNLPPTANQGVH
TADPLPLFAFGPGSENFFGMMDQTDLFFSMARALGLDATRNR
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccatgaaatatctgctcagccttgcgcttctggtctgtagcgccgcgtcggcg
gccgacctgaaggtctatccctacgacggggccaagttcgtgccgggtcagcggttcgac
ctgcggatcgaggccgagaacgtccagaactttcagggcgcggccgtcaccctcgacggc
cagccggtcgccgggctggtgcagacgaccaccaagcccaccagcgtcgagtggaccctg
cgcggccagagcctgcccaccggcctgcacgagctgagcgtgcgctaccgcgacgcggcg
ggcgaggcgaccaagaccgcgcgctggtacgtggtgcccgcagccgccgcccgcgccaag
aacgtcatcctgttcatcggggacggcatgggctggaataccgtgaacgccgcgcgcctc
atcgctcacccctacaatccgaccaacggcacgcccaccggccagctcgccatgatgagc
ggcctgagcggcatggcgagcgtcaccaccagctccttcgacagcgccctggccgacagc
gccaacaccgcgagcagcatcgccacgggccagaagattcaggtcaacgccctgaacgtg
taccccgacaacaccgccgacacgctcgacaacccgcgcgtcgagaccatcaccgcgatg
ctgaggcgcagcatgggcaagggcgtgggcatcgtgacgagcgccttcggggtggacgcc
acccccgccgccttcgccagctacacccgccgccgcggcgactactcggccatcgccgac
cagtatttcaagggcgacgtgcagcccgacgtgctgctcctgggcggcagccgcgacttc
atccccagcaccgcgccgggcagccgccgcaaggacaccaccgactggatcacggacagc
cagaagcagggctacaccttcgtcagcagccgcaccgagctgaacgcggccaacaccaac
aagctgttcggcctgttcaacatcgacaacatccccagctacctcgaccgcgcgcagtac
aagaccaccgaggccctgggcgacttcaaggacatgccctacctgtgggacagcaccaag
aaggccgtcgagacgctggagaagaaccccaacggctttttcctgatggtcgaggccggc
atggtggacaagtacgagcaccccctggactggcagcgcggcgtgtgggacgtcctggaa
ctcgacaaggcggtcgagtgggccaaggactacgccaagacccaccccgacaccctgatc
ctggtgacggccgaccacgcccactcgctgagcgtgtacggcggctacgacgcgaccaag
ggtcccggcaagcgcgaggcggtcggcgtgtacgagtcggccggcttccccacctacggc
gacaagcgtgacgccaacggcctgcccctgcccgagaccgcccgcacctacgcggtgggc
ttcgcggccgtgcccgactactgcgagacctacctgggccggcgcatcttcctcgacccg
accgtcagcaacggcaagactggcgccgaggccggctacctgcccaaccccaagatctgc
gaggaggggggcgtgacccgcaccggcaacctgccgcccaccgccaaccagggcgtgcac
accgccgaccccctgccgctgttcgccttcggccccggctcggagaacttcttcggcatg
atggaccagaccgacctgttcttctcgatggcccgcgccctgggcctggacgcgacccgc
aaccgctga

DBGET integrated database retrieval system