KEGG   Deinococcus gobiensis: DGo_CA0655Help
Entry
DGo_CA0655        CDS       T01827                                 

Gene name
speB
Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dgo  Deinococcus gobiensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    DGo_CA0655 (speB)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     DGo_CA0655 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715836..716663
Genome map
AA seq 275 aa AA seqDB search
MGVLGIPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGRTRLEGVTFADAGDVALPS
LEPELARGRITQAARALRERCRMSVFLGGDHSVTYPLLRAFADVPALHVVQLDAHLDFSD
TRNDTRYSNSSPFRRAAEALPNLVHITTIGLRGLRFDPEAVAAARARGHTLISMLDVQAG
LVGVLERLPSGQNVYLSVDADGLDPAVLPGTSSPEPDGLTYAQAMALLAATAKRNRVVGL
DLVELAPNLDPSGLSALIGARLVMETLCEVFDAGN
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtactgggcatccccttcgacatcgccctgggcttccggcccggggcccgcttc
gccccgcgtgcgctgcgggaggcgtccctgcgctccgtgccccctttcaccggtctggac
ggacgcacccggctggagggcgtgaccttcgccgatgcgggcgacgtggccctgcccagt
ctggagccggagctggcccgggggcgcatcacccaggcggcgcgggcgctgcgggaacgc
tgccgcatgtcggtgttcctgggcggcgaccacagcgtgacctacccgctgctgcgcgcc
ttcgcggacgtgcccgcgctgcatgtcgtgcagctcgacgcgcacctcgacttcagcgac
acgcgcaacgacacccgctacagcaactccagcccctttcgccgcgcggcagaggccctg
ccgaacctcgtccacatcaccaccatcggcctgcggggcctgcgcttcgaccccgaggcg
gtcgcggcggcgcgggcgcggggccacaccctgatttcgatgctggatgttcaggcgggg
ctggtgggcgtgctggagcgcctgcccagcggacagaacgtctacctcagcgtggacgcg
gacggcctcgaccctgccgtgctgcccggcacgtccagccccgagcccgacggcctgacc
tatgcgcaggcgatggccctgctggcggccacggcgaagcggaaccgcgtggtgggcctc
gatctggtggagctggctcccaacctcgaccccagcggcctgagcgccctgatcggcgcg
cggctggtcatggagacgctgtgtgaggtgttcgatgccggaaactga

DBGET integrated database retrieval system