KEGG   Deinococcus gobiensis: DGo_CA0714Help
Entry
DGo_CA0714        CDS       T01827                                 

Gene name
xylA
Definition
Xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
dgo  Deinococcus gobiensis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    DGo_CA0714 (xylA)
   00051 Fructose and mannose metabolism
    DGo_CA0714 (xylA)
Enzymes [BR:dgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     DGo_CA0714 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
783230..784195
Genome map
AA seq 321 aa AA seqDB search
MLYATRLNSLKARPELYFAPGPIRTPDLLARAARIQGLSSLSLNFPEHFTPATLRETKQT
IEALGLSVDSLNVRYPADTFGDGGFTHPDAAVRRSAIDLTCQALDACAELGGNHVIVWPG
FDGFDYPFQDSYERMFAHTVDGFAQVAAHNPAMRVGLEYKPWEPRKYSFIGNMGEAMLVV
NEVGADNLGVVLDYCHAQMANEHAPKAAALALRHDKLFGVHLNDGYGRQDDGMMVGTASL
VTTLELLMLLERSGYPGTIYFDTFPLREDPVRECEWNIRITERLLQLARELAADQSLGHG
HDAFNVTRVIERLLFPERVHA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctatacgccacccgccttaactctctcaaggcacgccccgagctgtatttcgccccg
ggaccgatccggacccccgacctgctcgcgcgcgcggcgcgcattcagggtctgagttcg
ctcagcctcaactttcccgagcacttcacccccgccaccctgcgcgagaccaagcagacc
atcgaggcgctgggcctgagcgtcgacagcctgaatgtccgctacccggcagacactttc
ggcgacggcggatttacccatccggacgcggccgtgcgccgttcggccattgacctgacc
tgtcaggccctggacgcctgcgccgagctgggtggcaaccacgtcatcgtctggccgggc
ttcgacggtttcgactaccccttccaggacagctatgagcgcatgttcgcgcacacggtg
gacggattcgcgcaggtggcggcccataaccccgccatgcgcgtcggtctggaatacaag
ccctgggagccgcgcaagtattcgttcatcggtaacatgggcgaggcgatgctcgtggtg
aacgaggtcggggccgacaacctgggcgtcgtgctggactactgccacgcccagatggcc
aacgaacacgcccccaaggccgccgcgctggccctgcgccacgataagctgttcggcgtc
cacctcaacgacggctacggccgccaggacgacggcatgatggtcggcacggccagcctc
gtcacgaccctggaactgctcatgctgctggagcgcagcgggtatccgggcaccatctac
ttcgacaccttccccctgcgcgaagaccccgtgcgcgaatgtgagtggaatatccgcatc
accgagcggctgctccagctcgcgcgtgagttggcggccgaccagagcctcgggcacggc
cacgacgccttcaacgtgacccgcgtcatcgagcgcctgctgtttccggaacgcgttcat
gcctga

DBGET integrated database retrieval system