KEGG   Deinococcus gobiensis: DGo_CA0828Help
Entry
DGo_CA0828        CDS       T01827                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA0828 (pfkA)
   01230 Biosynthesis of amino acids
    DGo_CA0828 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_CA0828 (pfkA)
   00030 Pentose phosphate pathway
    DGo_CA0828 (pfkA)
   00051 Fructose and mannose metabolism
    DGo_CA0828 (pfkA)
   00052 Galactose metabolism
    DGo_CA0828 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    DGo_CA0828 (pfkA)
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DGo_CA0828 (pfkA)
Protein phosphatases and associated proteins [BR:dgo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DGo_CA0828 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925491..926456
Genome map
AA seq 321 aa AA seqDB search
MKRLAVLTSGGDAPGMNAAIRAVVRTATQQGIEVVGVRRGFSGLHRGELAVLGPRDVANT
IQRGGTILLTARSHTWRSPEGRAKGAQVLRDWNVDGLIVIGGDGSFHGGHYLQEEHGVPV
IGVPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIFVIEVMGRHAGHIALD
VAVAGGAEEVFIPEDAKSVEGVVEIVKASVAKGKASSIIIVAEGYPGGAQGVADAIQNGT
GLETRVSILGHIQRGGAPVSSDRVLASRLGEAAVYALMDGEKGVMVGRGGGGIVYTPLHE
TWEKRKDVNRDLYRCAKTLSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcctcgcagtcctgacgagcggcggcgacgccccgggcatgaacgcggccatc
cgcgcggtcgtgcgcaccgcgacccagcagggcattgaggtcgtcggcgtgcgccggggc
ttctcgggcctgcaccggggcgaactcgcggtgctcgggccgcgcgacgtggcgaacacc
atccagcgcggcggcaccatcctgctcaccgcccgctcgcacacctggcgcagccccgag
ggccgggccaagggcgcgcaggtcctgcgcgactggaacgtggacggcctcatcgtcatc
ggcggcgacggcagcttccacggcgggcactacctccaggaagagcacggcgttccggtc
atcggcgtgccgggcaccatcgacaacgacctgtacggcaccgaccacaccatcgggtac
ttcacggcggtcgagacggcgctggacgccgtggacaagctgcgcgacaccggggcctcg
cacgagcgcatcttcgtgatcgaggtcatgggccgccacgccgggcacatcgcgctggac
gtggcggtggcgggcggcgccgaggaggtcttcattcccgaggacgccaagtcggtcgag
ggcgtggtcgagatcgtgaaggccagcgtcgccaagggcaaggccagcagcatcatcatc
gtggccgaggggtatccgggcggggcgcagggcgtggccgacgccatccagaacggcacc
ggtctggagacgcgcgtgagcatcctgggccacatccagcgcggcggcgcgccggtcagc
agcgaccgcgtgctggcgagccgcctgggcgaggcggccgtgtacgccctgatggacggg
gagaagggcgtgatggtcgggcgcggcggcggcggcatcgtgtacacccccctgcacgag
acctgggaaaagcgcaaggacgtgaaccgcgacctgtaccgctgtgccaagaccctgagt
atctga

DBGET integrated database retrieval system