KEGG   Deinococcus gobiensis: DGo_CA0828Help
Entry
DGo_CA0828        CDS       T01827                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:dgo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dgo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dgo00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dgo00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dgo00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dgo00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dgo00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925491..926456
Genome map
AA seq 321 aa AA seqDB search
MKRLAVLTSGGDAPGMNAAIRAVVRTATQQGIEVVGVRRGFSGLHRGELAVLGPRDVANT
IQRGGTILLTARSHTWRSPEGRAKGAQVLRDWNVDGLIVIGGDGSFHGGHYLQEEHGVPV
IGVPGTIDNDLYGTDHTIGYFTAVETALDAVDKLRDTGASHERIFVIEVMGRHAGHIALD
VAVAGGAEEVFIPEDAKSVEGVVEIVKASVAKGKASSIIIVAEGYPGGAQGVADAIQNGT
GLETRVSILGHIQRGGAPVSSDRVLASRLGEAAVYALMDGEKGVMVGRGGGGIVYTPLHE
TWEKRKDVNRDLYRCAKTLSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgcctcgcagtcctgacgagcggcggcgacgccccgggcatgaacgcggccatc
cgcgcggtcgtgcgcaccgcgacccagcagggcattgaggtcgtcggcgtgcgccggggc
ttctcgggcctgcaccggggcgaactcgcggtgctcgggccgcgcgacgtggcgaacacc
atccagcgcggcggcaccatcctgctcaccgcccgctcgcacacctggcgcagccccgag
ggccgggccaagggcgcgcaggtcctgcgcgactggaacgtggacggcctcatcgtcatc
ggcggcgacggcagcttccacggcgggcactacctccaggaagagcacggcgttccggtc
atcggcgtgccgggcaccatcgacaacgacctgtacggcaccgaccacaccatcgggtac
ttcacggcggtcgagacggcgctggacgccgtggacaagctgcgcgacaccggggcctcg
cacgagcgcatcttcgtgatcgaggtcatgggccgccacgccgggcacatcgcgctggac
gtggcggtggcgggcggcgccgaggaggtcttcattcccgaggacgccaagtcggtcgag
ggcgtggtcgagatcgtgaaggccagcgtcgccaagggcaaggccagcagcatcatcatc
gtggccgaggggtatccgggcggggcgcagggcgtggccgacgccatccagaacggcacc
ggtctggagacgcgcgtgagcatcctgggccacatccagcgcggcggcgcgccggtcagc
agcgaccgcgtgctggcgagccgcctgggcgaggcggccgtgtacgccctgatggacggg
gagaagggcgtgatggtcgggcgcggcggcggcggcatcgtgtacacccccctgcacgag
acctgggaaaagcgcaaggacgtgaaccgcgacctgtaccgctgtgccaagaccctgagt
atctga

DBGET integrated database retrieval system