KEGG   Deinococcus gobiensis: DGo_CA0896Help
Entry
DGo_CA0896        CDS       T01827                                 

Gene name
fpg
Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
dgo  Deinococcus gobiensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:dgo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
989766..990590
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETTRRKIEPLLRGQIITAVRHEPSHRYQGTQAAVGRRVKGLTRRGKYLMLQLA
APGAAESEPHDLELIVHLGMTGGFRLEPGKHTRVTLETGAGALHFDDPRRFGKMVVVRPG
EYAGMPTLSGMGPEPLSEDFREDEFVARAATAGAVKPWLLSQKPVSGVGNIYADEALWHA
RIHPAQTALNADEASRLYRAVREVMAQAVEAGGSSLGNGEGNYRQHDGEQGGFQGRHQAY
GRAGQPCARCGTPIAKIVLGQRGTHFCPQCQVVR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgccggaagtcgaaaccacccgccgcaagatcgagccgctgctgcgcggc
cagatcatcaccgccgtccggcacgagccgtcgcaccgctaccagggcacccaggcggcg
gtgggccggcgcgtgaagggcctgacccgccggggcaagtacctgatgctccagctcgcc
gcgccgggggcggccgagagcgagccccacgacctcgaactcatcgtgcatctggggatg
acgggaggcttccggctggagccgggcaagcacacccgcgtcacgctggagaccggcgcg
ggcgcgctgcatttcgacgacccccggcgcttcggcaagatggtggtcgtgcgtcccggc
gagtacgcgggcatgccgaccctctcgggcatggggcccgagccgctgtcggaggacttc
cgggaggacgagttcgtggcgcgcgcggccacggcgggggccgtgaagccctggctgctg
tcgcagaagcccgtgagcggtgtgggcaacatctacgccgacgaggcgctgtggcacgcc
cgcatccacccggcccagaccgccctgaacgcggacgaggcctcgcggctgtaccgcgcc
gtgcgcgaggtgatggcccaggcggtcgaggcgggcggcagttcgctgggcaacggcgag
ggcaactaccgccagcacgacggcgagcagggcggctttcagggccggcatcaggcctat
ggccgggccgggcagccgtgcgcgcgctgcggcacccccatcgccaagatcgtcctgggg
cagcgcggcacgcatttttgcccgcaatgtcaggtcgtgcgctga

DBGET integrated database retrieval system