KEGG   Deinococcus gobiensis: DGo_CA1072Help
Entry
DGo_CA1072        CDS       T01827                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DGo_CA1072 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DGo_CA1072 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DGo_CA1072 (trpB)
Enzymes [BR:dgo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DGo_CA1072 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1174515..1175756
Genome map
AA seq 413 aa AA seqDB search
MSLTIPAFPQPDGRGRYGRYGGRYVPETLIPALDELEAAYNEAKRDPEFLGELAGLFRDY
VNRPSTLYLARNLTAHAGGAKIYLKREDQNFTGAHKINNCLGQALLAKRMGKKKVIAETG
AGQHGVASATAAALLGLECVVYMGEEDIRRQALNVFRMKLLGAEVRPVTSGTGTLKDATN
EAIRDWVTNVRDTFYILGSVVGPHPYPAMVRDFQSVIGEEVKAQLLEHEGRSVPDAIVAC
VGGGSNAIGIFAPYAYLPPEQRPRLIGTEAAGEGVETGKHAASVAGGRVGVLHGSLMYLM
NDDEGQIIPPHSISAGLDYPGIGPEHCFYSDAGMAEYVPVTDAQSLEALQLLTRMEGIIP
AIESAHAIYYAVELARTMKPEEVIVVNLSGRGDKDVVEVMRLLGENPAGEAKA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgattcctgcttttccgcagccggacgggcgtgggcgctacggccgctac
ggtggccgctacgtgcctgagacgctcattccggccctcgacgaactcgaggccgcctac
aacgaggccaagcgcgaccctgagttcctgggcgaactcgccgggctgttccgcgactac
gtcaaccggcccagcaccctgtacctcgcgcgcaacctgacggcgcacgcgggcggcgcc
aagatctacctcaagcgcgaggaccagaacttcacgggcgcgcacaagatcaacaactgc
ctcgggcaggcgctgctcgccaagcgcatgggcaagaagaaggtcatcgccgagacgggc
gcgggccagcacggcgtcgcctcggccacggcggcggcgctgctgggcctggagtgcgtg
gtctacatgggcgaggaggacatccgccgtcaggccctcaacgtcttccgcatgaagctg
ctgggcgccgaggtccggcccgtgacgagcggcaccggtaccctcaaggacgccaccaac
gaggccatccgcgactgggtgaccaacgtgcgcgacaccttctacatcctgggcagcgtg
gtcgggccgcatccctacccggcgatggtccgcgacttccagagcgtgatcggcgaggaa
gtgaaggcgcaactgctggagcacgagggccgcagcgtgcccgacgccatcgtggcctgc
gtggggggcggcagcaacgccatcggtatcttcgcaccctacgcctatctgccgccggag
cagcgcccgcgcctgatcggtaccgaggccgccggcgagggcgtcgaaaccggcaagcac
gccgccagcgtggcggggggccgggtcggcgtgctgcacggctcgctgatgtacctcatg
aacgacgacgagggccagatcatcccgccgcactcgatcagcgcggggctggactacccc
ggcatcgggccggagcactgcttttacagcgacgcgggcatggccgagtacgtgcccgtg
accgacgcgcagtcgctcgaggccctgcaactcctgacgcgcatggaggggatcattccg
gccatcgagagcgcgcacgccatctactacgccgtggaactggcgcgcaccatgaagccc
gaggaagtgatcgtggtgaacctctcggggcgcggcgacaaggacgtggtcgaggtgatg
cgcctgctgggcgagaacccggccggggaggcgaaggcatga

DBGET integrated database retrieval system