KEGG   Deinococcus gobiensis: DGo_CA1212Help
Entry
DGo_CA1212        CDS       T01827                                 

Gene name
pfkB
Definition
Fructokinase RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dgo  Deinococcus gobiensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DGo_CA1212 (pfkB)
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DGo_CA1212 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1321077..1321910
Genome map
AA seq 277 aa AA seqDB search
MQPGGAGGTISVTLARLGHTVTLAARVGDDPFAEYALAQVRESGVSESAIQRDPDVLTST
ITVLQTPGGERAMISDGATNRLLDPAKLKKRDIETTDALIVSGYSLTEGPQREYALKAIE
IAKAAKKKVPVFIDLGTGAVNKVGTKLVQDVVAADYLTLNQHELLALTGTGSLSAALAQL
GGAGARQVAVKVGKMGSVVWSPEETELVDSVIPEKPVVDSTGAGDTFTAAFAHAVLNGAP
LSKAARAANAAGALAATTVGAQSREITAADLERALGR
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgggcggggcgggcggcaccatcagcgtgacgctggcccgcctgggccacacc
gtgacgctggccgcgcgtgtgggcgacgatcctttcgccgaatacgcgctggcccaggtg
cgcgagagcggcgtctcggaaagcgccatccagcgcgatcccgacgtgctcacgagcacc
atcaccgtcctccagacccccggcggcgaacgcgccatgatcagcgacggggccaccaac
cgtctgctggaccccgccaagctgaagaagcgcgacatcgagaccaccgacgccctgatc
gtcagcggctacagcctgaccgaaggtccgcagcgcgagtacgccctgaaggccatcgag
atcgccaaagcggccaagaagaaggtgccggtgttcatcgacctcggcacgggcgcggtg
aacaaggtggggaccaagctcgtgcaggacgtggtcgctgccgattacctcaccctgaac
cagcacgaactgctcgccctgaccggcaccggcagcctcagcgcggcgctcgcgcagctc
ggcggcgcgggggcccggcaggtcgccgtgaaggtcggcaagatgggcagcgtcgtgtgg
tcgcccgaggaaaccgaactggtggactcggtgattcccgagaagccggtcgtggacagc
accggggcgggagacaccttcacggcggccttcgcgcacgcggtgctgaacggcgcgccg
ctctcgaaggccgcccgcgcggcgaacgcggcgggcgcgctggccgccacgaccgtcggc
gcgcagagccgcgagatcacggccgccgacctggaacgggcgctcggccgctga

DBGET integrated database retrieval system