KEGG   Deinococcus gobiensis: DGo_CA1271Help
Entry
DGo_CA1271        CDS       T01827                                 

Gene name
aceA
Definition
acillus halodurans Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
dgo  Deinococcus gobiensis
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:dgo01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:dgo00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1388885..1390195)
Genome map
AA seq 436 aa AA seqDB search
MTAQPRTPAEILSKTWQTEDRWQGVRRNYSADDVVKLRGSLMVEQTLAKRGAEKLWRLMR
EEPFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANNAGQMYPDQSLYPASSVPDVV
KRINNTLRRADQIQHSEGRHDVDYFAPIVADAEAGFGGPLNAFELMKAMIEAGAAGVHFE
DQLASEKKCGHLGGKVLVPTSQFIRTLNAARLAADVSAVPTVLIARTDADAANLLTSDVD
DNDKPFCTGERTPEGFYYVRPGIEQAISRALAYAPYADVLWCETSIPNLEDARRFAEAVH
AQFPGKLLAYNCSPSFNWRKNLDDETIARFQVELGRLGYKFQFITLAGFHSLNMGMFDLA
YGYARNQMTSFVELQEREFAAQERGFTAVKHQREVGTGYFDLVAQAAGGGQSSTTALAGS
TEAQQFGHRELAGVHD
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacagccccgcacccccgccgagatcctgagcaagacctggcagaccgaagac
cgctggcagggcgtccgccgcaactactcggccgacgacgtggtcaagctgcgcggcagc
ctgatggtcgagcagaccctcgccaagcgcggggccgagaaactctggcggctgatgcgc
gaggaacccttcgtgaacgcgctcggggccctgaccggcaaccaggccatgcagcaggtc
aaggcggggctcaaggccatctacctctcgggctggcaggtcgcgggcgacgccaacaac
gccgggcagatgtatcccgaccagagcctgtaccccgcctccagcgtgcccgacgtggtc
aagcgcatcaacaacacgctgcgccgggccgaccagatccagcacagcgagggccggcac
gacgtggactacttcgcgcccatcgtggccgacgccgaggcgggcttcggcggccccctg
aacgccttcgagctgatgaaggccatgatcgaggcgggcgcggcgggcgtgcacttcgag
gaccagctcgctagcgagaagaaatgcgggcacctgggcggcaaggtcctggtgcccacc
tcgcagttcatccggacgctgaacgcggcccgcctcgccgccgacgtgtcggccgtgccc
acggtactcatcgcgcgcaccgacgccgacgccgccaacctgctgacgagcgacgtggac
gacaacgacaagcctttctgcaccggcgagcgcacccccgagggcttctactacgtccgg
cccggtatcgagcaggccatttcccgcgccctggcctacgccccctacgccgacgtgctc
tggtgcgaaaccagcattcccaacctggaagacgcccgccgctttgccgaggccgtccac
gcgcagtttccgggcaagctgctggcctacaactgctcgccctcgttcaactggcgcaag
aacctggacgacgagaccatcgcccggttccaggtcgaactgggccggctcgggtacaag
ttccagttcatcacgctggccgggttccacagcctgaacatgggaatgttcgacctcgcc
tacggctacgcccgcaaccagatgaccagtttcgtcgagttgcaggagcgcgaatttgcg
gcgcaggaacgcgggttcacggccgtcaagcaccagcgggaagtggggaccggctacttc
gacctcgtggcgcaggcggcgggcggcggccagagcagcacgaccgccctggccggcagc
accgaggcccagcagttcggacaccgcgagctggccggcgtacacgactga

DBGET integrated database retrieval system