KEGG   Deinococcus gobiensis: DGo_CA1340Help
Entry
DGo_CA1340        CDS       T01827                                 

Gene name
agaL
Definition
Glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
dgo  Deinococcus gobiensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DGo_CA1340 (agaL)
  Lipid metabolism
   00561 Glycerolipid metabolism
    DGo_CA1340 (agaL)
   00600 Sphingolipid metabolism
    DGo_CA1340 (agaL)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DGo_CA1340 (agaL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462581..1463921)
Genome map
AA seq 446 aa AA seqDB search
MTTPKIAFVGAGSTVFAKNLLGDILSFPELGGADIRLFDINQERLDVTEQVAHRVARTVG
ASPRVIATTDRDRALDGADFVINMIQVGGYQPATVTDFEVPKAYGLRQTIADTLGIGGIM
RALRTVPVLADMSRDMERLCPDTLHLNYVNPMAMNIWGLARLTPRVKTVGLCHSVQHTAE
ELAKDLGIPVEEIDYLCAGINHMAFYLKFEHRGQSLYPRLMELAESGQVPEWNRVRYEML
RRLGSFVTESSEHFSEYVPYFIKRGRDDLLEKFNVPLDEYPRRCVSQIGGWEDLRTKLQN
PDEPLEVTRSVEYGSLIIHSMVTGQPRVVYGNVMNSPLDGSAGKLIANLPDECSVEVPCL
VDRQGIQPTRIGRIPPQLAGLMQTNINVQALTVEAIVTGNREHIFHAAMLDPHTSAELDL
DQIWALTNDLLNQHGDFIPETLQAAD
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccccaagatcgccttcgtcggtgccggcagcacggtcttcgccaagaacctg
ctcggggacatcctgagcttccccgaactcggtggggccgacatccggctctttgacatc
aaccaggagcggctcgacgtgaccgagcaggtcgcgcaccgcgtcgcccgtacggtcggc
gcctcgccccgcgtgatcgccacgaccgaccgcgaccgtgcgctcgacggagccgatttc
gtcatcaacatgatccaggtgggcggctaccagcccgcgaccgtgaccgacttcgaggtg
cctaaggcttacggcctgcgccagaccatcgccgacaccctgggcatcggcggcatcatg
cgggcgctgcgcaccgtgcccgtgctcgccgacatgagccgcgacatggagcggctgtgc
cccgacaccctgcacctgaactacgtcaacccgatggcgatgaacatctggggtctggcg
cgcctcacgccgcgcgttaagaccgtgggcctgtgccacagcgtgcagcacaccgccgag
gaactggcgaaggacctcgggattccggtcgaagagattgattacctgtgcgccggcatc
aaccacatggccttctacctcaagttcgagcaccggggccagagcctctacccgcgcctg
atggaactggccgagtccgggcaggtgcccgagtggaaccgcgtgcgctacgagatgctg
cggcgcctgggctccttcgtgaccgagagcagcgagcatttctcggagtacgtgccctac
ttcatcaagcgcgggcgcgacgacctgctggagaaattcaacgtgccgctcgacgagtac
ccgcgccgctgcgtctcgcagatcggcggctgggaggacctgcgcacgaaactccagaac
cccgacgagccgctggaggtgacgcgcagcgtggagtacggctcgctcatcatccacagc
atggtgacgggccagccgcgcgtggtgtacggcaacgtgatgaacagccccctggacggc
tcggccggcaagctcatcgccaacctgcccgacgagtgcagcgtggaggtgccctgcctg
gtggaccgccagggcatccagcccacgcgcatcgggcgcatcccgccgcagctcgcgggc
ctgatgcagaccaacatcaacgtgcaggccctgaccgtcgaggccatcgtgaccggcaac
cgcgagcacatcttccatgcggcgatgctcgacccgcacacgagcgccgaactcgacctc
gaccagatctgggcactgacgaacgacctgctcaaccagcacggcgacttcatcccggag
acgctccaggccgccgactga

DBGET integrated database retrieval system