KEGG   Deinococcus gobiensis: DGo_CA1393Help
Entry
DGo_CA1393        CDS       T01827                                 

Gene name
sdhC
Definition
(GenBank) Succinate dehydrogenase, cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00020  Citrate cycle (TCA cycle)
dgo00190  Oxidative phosphorylation
dgo00650  Butanoate metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01200  Carbon metabolism
Module
dgo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dgo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA1393 (sdhC)
   00650 Butanoate metabolism
    DGo_CA1393 (sdhC)
  Energy metabolism
   00190 Oxidative phosphorylation
    DGo_CA1393 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS VirB8 DUF3675
Motif
Other DBs
NCBI-ProteinID: AFD25320
UniProt: H8GTJ2
Position
complement(1515020..1515397)
Genome map
AA seq 125 aa AA seqDB search
MIRARTFMDARQQAHSNAELNWWIFMRISGLILMFLVLGHVYMTFVQVSESDATFDAVVS
KLGNPAWKLYDWLILGLALLHGGNGARYVIDDYVRSRPNRAWVRNTFFTVLALLFVFGTV
GLFAI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcccgaacctttatggacgcccgccagcaggcacattccaacgccgaactg
aactggtggatcttcatgcgtatcagcggcctgatcctgatgttcctggtgctggggcac
gtctacatgaccttcgtgcaggtcagcgagtccgacgccaccttcgacgcggtggtcagc
aagctgggcaaccctgcctggaagctgtacgactggctgattctgggcctggccctgctg
cacggcggcaacggcgcgcgctacgtcatcgacgactacgtgcgctcccgtcccaaccgc
gcctgggtgcgcaacaccttcttcaccgtcctggcactgctgttcgtgttcggtacggtg
ggcctgttcgccatctga

DBGET integrated database retrieval system