KEGG   Deinococcus gobiensis: DGo_CA1393Help
Entry
DGo_CA1393        CDS       T01827                                 

Gene name
sdhC
Definition
Succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
dgo  Deinococcus gobiensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA1393 (sdhC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA1393 (sdhC)
   00650 Butanoate metabolism
    DGo_CA1393 (sdhC)
  Energy metabolism
   00190 Oxidative phosphorylation
    DGo_CA1393 (sdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1515020..1515397)
Genome map
AA seq 125 aa AA seqDB search
MIRARTFMDARQQAHSNAELNWWIFMRISGLILMFLVLGHVYMTFVQVSESDATFDAVVS
KLGNPAWKLYDWLILGLALLHGGNGARYVIDDYVRSRPNRAWVRNTFFTVLALLFVFGTV
GLFAI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgcccgaacctttatggacgcccgccagcaggcacattccaacgccgaactg
aactggtggatcttcatgcgtatcagcggcctgatcctgatgttcctggtgctggggcac
gtctacatgaccttcgtgcaggtcagcgagtccgacgccaccttcgacgcggtggtcagc
aagctgggcaaccctgcctggaagctgtacgactggctgattctgggcctggccctgctg
cacggcggcaacggcgcgcgctacgtcatcgacgactacgtgcgctcccgtcccaaccgc
gcctgggtgcgcaacaccttcttcaccgtcctggcactgctgttcgtgttcggtacggtg
ggcctgttcgccatctga

DBGET integrated database retrieval system