KEGG   Deinococcus gobiensis: DGo_CA1498Help
Entry
DGo_CA1498        CDS       T01827                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dgo  Deinococcus gobiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGo_CA1498
Enzymes [BR:dgo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     DGo_CA1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1630730..1632247)
Genome map
AA seq 505 aa AA seqDB search
MTLQRSSGVLLHPTSLPGPYGIGELGAQARHFVDWLAQAGQTYWQVMPLGPTGYGDSPYQ
AFSAFAGNPYLIDLSTLKAEGLLQDSDFAAMPDFSPTKVDFGVQYVWRNQMLDRAYAAFA
FGGAQELRADFDAFRASEADWLDDYALFMALKDAHGGLPWNAWEPGTRDRDPEALAAARE
RLAAAIERVQFVQFLFFRQWNEVRAYARERGVQVIGDIPIFVAMDSSDAWAARDQFYFDD
QGQPTVVAGVPPDYFSETGQLWGNPLYDWDAMRASNYAWWVKRFQGSLKLYDIIRIDHFR
GFAAYWEIPFPAETAINGRWVPAPGHEMFQAVRDALGALPIIAEDLGVITPDVEQLRDDF
EFPGMAVLQFAFGGGDFSVNDFLPHNLRENQVVYTGTHDNDTTRGWWIAADESERHNFRV
YTSSDPSEQTFTPQLMRMAFESRARLAVVPLQDVMNLGTEARMNLPGTTGDHNWTWRYDP
AALLPSLATSLRALTESTGRLQRRD
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttcaacgctcaagtggggtgctgctgcacccgaccagcctgcccggcccctac
ggcatcggtgaactgggggcgcaggcccggcatttcgtggactggctcgcgcaggccggg
cagacctactggcaggtcatgccgctggggccgaccggctacggcgacagcccctatcag
gcgttcagcgccttcgccggcaacccctacctcatcgacctgagcaccctcaaggccgag
ggcctgcttcaggacagcgacttcgccgccatgccggacttcagccccaccaaggtggat
ttcggcgtgcagtacgtgtggcgtaaccagatgctcgaccgggcctacgcggctttcgcc
ttcggcggggcgcaggagctgcgcgcggacttcgacgccttccgggccagcgaggccgac
tggctcgacgactacgccctgttcatggccctcaaggacgcgcacggcggcctgccctgg
aacgcctgggagccgggaacccgcgaccgcgaccccgaggccctcgcggcggcgcgcgag
cggctggcggcggccatcgaacgcgtgcagttcgtgcagttcctgtttttccggcagtgg
aacgaggtccgcgcctatgcccgcgaacgcggcgtgcaggtcatcggggacattccgatc
ttcgtggcgatggacagcagcgacgcctgggcggcccgcgaccagttctacttcgacgac
cagggccagccgaccgtggtggcgggcgtgccgccggactacttcagcgagaccgggcag
ctctggggcaacccgctgtacgactgggacgccatgcgggccagcaactacgcctggtgg
gtcaagcgcttccagggcagcctgaagctctacgacatcatccgtatcgaccacttccgg
gggttcgcggcgtactgggaaattccctttccggccgaaaccgccatcaacggccgctgg
gtccccgcccccggccacgagatgttccaggccgtgcgcgacgcgctgggcgcgctgccc
atcatcgccgaggacctgggggtcatcacgccggacgtcgagcagctgcgcgacgacttc
gagtttccgggcatggcggtcctccagttcgccttcgggggcggcgacttcagcgtgaac
gacttcctgccgcacaacctgcgcgagaatcaggtcgtgtacaccggcacgcacgacaac
gacacgacgcgcggctggtggatcgcggccgacgagagcgaacgccacaacttccgggtg
tacacgagcagcgaccccagcgagcagaccttcacgccccagctcatgcgcatggccttc
gagagccgcgccaggctggccgtcgtgccgcttcaggacgtgatgaacctgggcaccgag
gcgcgcatgaacctgcccggcacgaccggcgaccacaactggacgtggcgctacgacccg
gcggcgctgctccccagcctcgccacgtcgctgcgcgcactgaccgagagcaccggccga
ctccagcgcagggactag

DBGET integrated database retrieval system