KEGG   Deinococcus gobiensis: DGo_CA1508Help
Entry
DGo_CA1508        CDS       T01827                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dgo  Deinococcus gobiensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DGo_CA1508 (ruvA)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DGo_CA1508 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640979..1641581
Genome map
AA seq 200 aa AA seqDB search
MIAYLSGVVREVREGSAVVVAGGVGYEVQCPASTLGRLKVGEVAELSTRFVVREDAQLLF
GFSDADSLKLFDLLTGVSGVGPKLGLALLSAMPPSAVAQGLLSGDVKLLSSVSGVGKKTA
ERLVLELQNKVPEHLAAGATAGGGARVARVDSTAGRDAVDALLALGFREAQVRAAVSELL
AADPAQTADALIRKSLGKLR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttacctgtccggcgtggtgcgtgaagtgcgtgaggggagcgccgtcgtcgtg
gcgggcggcgtgggctacgaggtgcagtgcccggccagtaccctgggccgcctgaaggtc
ggcgaggtggccgaactcagcacccggttcgtcgtgcgcgaggacgcccagctcctgttc
ggcttcagtgatgccgacagcctcaagctcttcgacctgctgaccggcgtctcgggggtc
ggccccaagctggggctcgcgctgctctcggccatgccgccctcggcggtcgcgcagggc
ctgctctcgggcgacgtgaaactgctctccagcgtctcgggtgtgggcaagaagaccgcc
gagcgcctcgtcctcgaactccagaacaaggtgcccgaacacctcgcggccggggcgacg
gccggtgggggcgcgcgggtcgcccgggtggacagcaccgccgggcgcgacgcggtggac
gccctgctggccctgggcttccgcgaggcgcaggtgcgcgcggccgtctccgaactgctg
gccgccgacccggcgcagaccgccgacgccctgatccgcaagtcgctcggcaaactgcgg
tga

DBGET integrated database retrieval system