KEGG   Deinococcus gobiensis: DGo_CA1559Help
Entry
DGo_CA1559        CDS       T01827                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00010  Glycolysis / Gluconeogenesis
dgo00051  Fructose and mannose metabolism
dgo00562  Inositol phosphate metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01200  Carbon metabolism
dgo01230  Biosynthesis of amino acids
Module
dgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dgo_M00002  Glycolysis, core module involving three-carbon compounds
dgo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_CA1559 (tpiA)
   00051 Fructose and mannose metabolism
    DGo_CA1559 (tpiA)
   00562 Inositol phosphate metabolism
    DGo_CA1559 (tpiA)
Enzymes [BR:dgo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DGo_CA1559 (tpiA)
Exosome [BR:dgo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DGo_CA1559 (tpiA)
  Exosomal proteins of bladder cancer cells
   DGo_CA1559 (tpiA)
  Exosomal proteins of melanoma cells
   DGo_CA1559 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFD25486
UniProt: H8GUW9
Position
complement(1685721..1686422)
Genome map
AA seq 233 aa AA seqDB search
MNKTPSEARAWAEDLAERLSPGDAELAVMAPAIALPALAAHLPAGVSVGAQDLSAHESGA
YTGEISAAMLVDVGTRYAVVGHSERREYHGESDAVVAAKARQAQQNGITPIVCVGEGLDV
RERGEQVPYTLTQLAGSLEGVGEDVVVAYEPVWAIGTGKTATADDAEELASAIREALRER
YGNAAEEVRVLYGGSVKPDNIAAICAKPNVNGALVGGASLKVPDVLGMNDALK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaccccctccgaggcccgcgcctgggccgaggacctcgcggagcgcctctcg
cccggcgacgccgagctggccgtgatggccccggccatcgccctgcccgcgctggccgcg
cacctgccggccggcgtgtcggtcggcgcgcaggacctctcggcgcacgagtcgggcgcg
tacaccggcgagatcagcgcggcgatgctggtggacgtgggcacgcgctacgcggtcgtg
ggccacagcgagcgccgcgagtaccacggcgagagtgacgccgtggtcgcggccaaggcc
cggcaggcgcagcagaacggcatcacgcccatcgtgtgcgtgggcgagggcctggacgtg
cgcgagcgcggcgagcaggtgccctacaccctcacgcagctcgcgggcagcctggaaggc
gtgggcgaggacgtggtcgtggcctacgagcctgtgtgggccatcggcaccggcaagacc
gccacggccgacgacgccgaggaactcgcctcggccatccgggaggcgctgcgtgagcgc
tacggcaacgctgccgaggaagtgcgcgtgctgtacggcggcagcgtgaagcccgacaac
atcgccgccatctgcgccaagccgaacgtgaacggcgcgctggtcggcggcgcgagcctc
aaggtgcccgacgtgctgggcatgaacgacgccctgaagtaa

DBGET integrated database retrieval system