KEGG   Deinococcus gobiensis: DGo_CA1597Help
Entry
DGo_CA1597        CDS       T01827                                 

Definition
Succinyl-CoA ligase
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dgo  Deinococcus gobiensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA1597
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA1597
   00640 Propanoate metabolism
    DGo_CA1597
   00660 C5-Branched dibasic acid metabolism
    DGo_CA1597
Enzymes [BR:dgo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DGo_CA1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1726900..1728057)
Genome map
AA seq 385 aa AA seqDB search
MKLHEYQGKEILRQFGVNVQDGKVARTPDEVRGIAREYGQPVVVKAQVHVGGRGKAGGVK
FSPTEDKAFENGEKILGMDIKGLTVNKVLVTKAVDIDAGTEYYVGMIVDRNVQSYTLMAS
AEGGMEIEEVAAATPDKIIKHRVDPVTGLRPYEAREVAIKAGFKGNLNKIADMMVKMSEA
ALARDAVLVEINPLFVDESGTPLALDTKFEIDDNAMYRHKDLADWRELEAEHPLEIEASK
YGFAYVKLDGNVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGAKADIVYNAVKLVSK
DSDVKAIFINIFGGITRADEVAKGVIQALQDGILTKPVRMRIAGTAEDEAKALLAEVNSP
LIQMYPTMFEAADEAAKEANNAEAK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacttcacgagtatcagggcaaggagattctgcgccagtttggcgtgaacgtgcag
gacggcaaggtcgcccgcacgcccgacgaagtgcgcggcatcgcccgcgagtacggccag
ccggtcgtggtcaaggcgcaggtccacgtcggtggacgcggcaaggccggcggcgtgaag
ttcagccccaccgaggacaaggccttcgagaacggcgagaagatcctgggcatggacatc
aagggcctgaccgtcaacaaggtcctcgtgaccaaggccgtggacatcgacgcgggcacc
gagtactacgtgggcatgatcgtggaccgcaacgtccagagctacaccctcatggcctcg
gccgagggcggtatggaaatcgaggaagtcgccgccgcgacccccgacaagatcatcaag
caccgcgtggaccccgtcaccggcctgcggccctacgaggcgcgcgaggtggcgatcaag
gccggcttcaagggcaacctcaacaagatcgccgacatgatggtcaagatgagcgaggcc
gcgctggcgcgtgacgccgtgctcgtcgagatcaacccgctgttcgtggacgagtcgggc
accccgctggccctggacaccaagttcgagatcgacgacaacgcgatgtaccgccacaag
gacctcgccgactggcgcgaactcgaagccgagcacccgctggagatcgaagccagcaag
tacggcttcgcctacgtcaagctcgacggcaacgtcggcgtgctgggcaacggcgcgggc
atcgtgatgacctcgctcgacgtggtcaaccgcgccggcgccaagcccgccaacttcctg
gacatcggcggcggcgccaaggccgacatcgtgtacaacgccgtcaagctcgtcagcaag
gacagcgacgtcaaggccatcttcatcaacatcttcggcggcatcacccgcgccgacgag
gtcgccaagggcgtcatccaggccctccaggacggcatcctgaccaagccggtgcgcatg
cgcatcgccggcacggccgaggatgaggccaaggcgctgctcgcggaagtgaacagcccc
ctgatccagatgtaccccaccatgttcgaggccgccgacgaggccgccaaggaagccaac
aacgcggaggccaagtaa

DBGET integrated database retrieval system