KEGG   Deinococcus gobiensis: DGo_CA1597Help
Entry
DGo_CA1597        CDS       T01827                                 

Definition
(GenBank) Succinyl-CoA ligase
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00020  Citrate cycle (TCA cycle)
dgo00640  Propanoate metabolism
dgo00660  C5-Branched dibasic acid metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01200  Carbon metabolism
Module
dgo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dgo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DGo_CA1597
   00640 Propanoate metabolism
    DGo_CA1597
   00660 C5-Branched dibasic acid metabolism
    DGo_CA1597
Enzymes [BR:dgo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     DGo_CA1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFD25524
UniProt: H8GV07
Position
complement(1726900..1728057)
Genome map
AA seq 385 aa AA seqDB search
MKLHEYQGKEILRQFGVNVQDGKVARTPDEVRGIAREYGQPVVVKAQVHVGGRGKAGGVK
FSPTEDKAFENGEKILGMDIKGLTVNKVLVTKAVDIDAGTEYYVGMIVDRNVQSYTLMAS
AEGGMEIEEVAAATPDKIIKHRVDPVTGLRPYEAREVAIKAGFKGNLNKIADMMVKMSEA
ALARDAVLVEINPLFVDESGTPLALDTKFEIDDNAMYRHKDLADWRELEAEHPLEIEASK
YGFAYVKLDGNVGVLGNGAGIVMTSLDVVNRAGAKPANFLDIGGGAKADIVYNAVKLVSK
DSDVKAIFINIFGGITRADEVAKGVIQALQDGILTKPVRMRIAGTAEDEAKALLAEVNSP
LIQMYPTMFEAADEAAKEANNAEAK
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacttcacgagtatcagggcaaggagattctgcgccagtttggcgtgaacgtgcag
gacggcaaggtcgcccgcacgcccgacgaagtgcgcggcatcgcccgcgagtacggccag
ccggtcgtggtcaaggcgcaggtccacgtcggtggacgcggcaaggccggcggcgtgaag
ttcagccccaccgaggacaaggccttcgagaacggcgagaagatcctgggcatggacatc
aagggcctgaccgtcaacaaggtcctcgtgaccaaggccgtggacatcgacgcgggcacc
gagtactacgtgggcatgatcgtggaccgcaacgtccagagctacaccctcatggcctcg
gccgagggcggtatggaaatcgaggaagtcgccgccgcgacccccgacaagatcatcaag
caccgcgtggaccccgtcaccggcctgcggccctacgaggcgcgcgaggtggcgatcaag
gccggcttcaagggcaacctcaacaagatcgccgacatgatggtcaagatgagcgaggcc
gcgctggcgcgtgacgccgtgctcgtcgagatcaacccgctgttcgtggacgagtcgggc
accccgctggccctggacaccaagttcgagatcgacgacaacgcgatgtaccgccacaag
gacctcgccgactggcgcgaactcgaagccgagcacccgctggagatcgaagccagcaag
tacggcttcgcctacgtcaagctcgacggcaacgtcggcgtgctgggcaacggcgcgggc
atcgtgatgacctcgctcgacgtggtcaaccgcgccggcgccaagcccgccaacttcctg
gacatcggcggcggcgccaaggccgacatcgtgtacaacgccgtcaagctcgtcagcaag
gacagcgacgtcaaggccatcttcatcaacatcttcggcggcatcacccgcgccgacgag
gtcgccaagggcgtcatccaggccctccaggacggcatcctgaccaagccggtgcgcatg
cgcatcgccggcacggccgaggatgaggccaaggcgctgctcgcggaagtgaacagcccc
ctgatccagatgtaccccaccatgttcgaggccgccgacgaggccgccaaggaagccaac
aacgcggaggccaagtaa

DBGET integrated database retrieval system