KEGG   Deinococcus gobiensis: DGo_CA1756Help
Entry
DGo_CA1756        CDS       T01827                                 

Definition
(GenBank) Peptidase M42 family protein
Organism
dgo  Deinococcus gobiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1890166..1891263
Genome map
AA seq 365 aa AA seqDB search
MSGDFSPVMEYLRQLVEVTGPSGSEEDVARRVLELARPHADELSVDAVGNVVAVRRAADP
SARRLLICAHMDEIGFRVRRVDEGGTLRLEKVGGSDDRILPAQRVWVRTEEGRIPGVIGT
KSAHLLTDADRASVTPYAQLYVDIGARSAGEAAAMGVRPGDPVGFAGELTELGRNSGRYT
AHALDDRAGCAVLLALLAGFSGDARPPVTLVAAFSVQEEVGLRGAQVLARALPAGQTPDV
ALALDMTAADDTPELGAPTLRLGAGPTVKVMDFSTLAHPAVRRGLLRAAQTRDLPVQHEL
LKGIGTDAGALQYLGVPTGAVSVTNRYTHSPVEVLDRRDLEAAQALLLGFMHDLPETPLD
FLPTP
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcgatttctcgcccgtcatggagtatctgcgccagctcgtggaggtcaccggc
cccagcggcagcgaggaggacgtggcccggcgcgtgctggagctcgcccggccccacgcc
gacgagctgagcgtggacgcggtgggcaacgtggtcgcggtgcgccgcgccgccgacccc
tcggcgcggcggctgctgatctgcgcgcacatggacgagatcggcttccgggtgcggcgc
gtggacgagggcggcaccctgcgcctggaaaaggtgggcggcagcgacgaccggattctg
ccggcccagcgcgtgtgggtgcgcaccgaggagggccggattccgggtgtgatcggcacc
aagagcgcgcacctgctgaccgacgccgaccgcgcgagcgtcacgccctacgcgcagctg
tacgtggacatcggcgcccgcagcgccggcgaggccgccgcgatgggcgtgcggcccggc
gacccggtgggtttcgccggcgagctgaccgagctgggccggaacagcggacgctacacc
gcccacgccctggacgaccgggcgggctgcgcggtgctgctggcgctgctcgcgggcttc
agcggcgacgcccggccccccgtcacgctcgtcgccgccttctcggtgcaggaggaggtc
gggctgcgcggcgcgcaggtcctcgcccgcgccctgccggccgggcagaccccggacgtg
gccctggccctggacatgacggccgccgacgacacccccgaactcggtgcgcccacgctg
cggctgggggccggcccgaccgtcaaggtcatggatttctcgaccctggcccacccggcg
gtgcggcgggggctcctgcgtgccgcgcagacccgagacctgccggtgcaacacgaactc
ctcaaaggcatcggcaccgacgcgggcgcgctgcaatacctcggcgtgccgaccggggcc
gtgtcggtcaccaaccgttacacccacagccccgtcgaggtgctcgaccgccgcgacctg
gaggcggcgcaggccctgctgctgggcttcatgcacgacctgccggagacgccgctggat
ttcctgcctacgccctga

DBGET integrated database retrieval system