KEGG   Deinococcus gobiensis: DGo_CA1825Help
Entry
DGo_CA1825        CDS       T01827                                 

Gene name
recD
Definition
Helicase RecD/TraA
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dgo  Deinococcus gobiensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DGo_CA1825 (recD)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DGo_CA1825 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1967814..1969922)
Genome map
AA seq 702 aa AA seqDB search
MTVASPTEPFRVSGGVNKVRFRADSGFTVMTARIRNDEGEDPDATVIGLMPPLEAGDTFS
ADVLLEEHREYGHQYRVLNMVLEATPADLTEAGVAAYLEARVGGVGKVLAARLAKAFGAE
AFDLLEHDPQRLLQVPGVTQSTLHKMVSSWSQQGLERRLLAGLQGLGLSISQAQRAVKHF
GEAALERLQADLFALTEVEGIGFLTADKLWQGAGGSLDDPRRLTAAAVYALQQAAQQSGH
SFLPRDRAERGVAHYTRVSPEQARLAVETAVELGRLKDDSVGDTSRIYLPPVLRAEKKLA
TLVRTLLATPPGGDEWTVTVGAEVGLSDEQASVLHLMEEHRLVVLTGGPGTGKSTTTRAV
ADLAESLGLEVGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPAGFRHNHLEPAPYDLLI
VDEVSMMGDGLMLSLLAAVPPGARVLLVGDTDQLPPVDAGLPLLALAQVAPTVTLTQVYR
QAAENPIIRAAHGLLHARAPEWGDPRLTLTETEPDVGARRVALMVRDLGGPAAVQVLTPM
RKGPLGMDALNAQLQSLFNPGEGGVRIAEGHARPGDTVVQTKNDYTNEIFNGTLGTVLKA
EGGRLTVDFDGNVVDLAGAELFNLQLGYALTVHRAQGSEWPQVLGVLHEAHMPMLSRNLV
YTALTRARDRFHAAGSASAWVRAAGRQREARNTALLERIQTR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtagcctccccaaccgagccgttccgggtgtccgggggcgtaaacaaagtgcgc
ttccgggccgacagcggcttcaccgtcatgaccgcccggattcgcaacgacgagggcgag
gaccccgacgccaccgtcatcggcctgatgccgccgctggaggcgggcgacaccttcagc
gccgacgtgctgctcgaagaacaccgcgagtacggccaccagtaccgcgtgctgaacatg
gtcctggaggccacgcccgccgacctgaccgaggccggggtcgccgcctatctcgaagcg
cgcgtgggcggggtgggcaaggtgctggccgcccggcttgccaaggctttcggggccgag
gccttcgacctgctggagcacgacccgcagcgcctcttgcaggtgccgggcgtcacccag
agcaccctgcacaagatggtgtcgagctggagccagcaggggctggagcggcggctgctc
gcggggctccagggcctgggcctgagcatctcgcaggcgcagcgggccgtgaagcacttc
ggcgaggcggccctggagcgcctccaggccgacctcttcgcgttgaccgaggtcgagggc
atcgggttcctgaccgccgacaagctgtggcagggcgcgggcggctcgctcgacgacccc
cgccgtctcacggccgccgccgtatacgcgctgcaacaggccgcgcagcagagcggccac
agcttcctgccgcgcgaccgggccgagcgcggcgtggcgcattacacccgcgtctcgccc
gagcaggcccggctggcggtcgagacggcggtcgaactcggccgcctcaaggacgacagc
gtgggcgacaccagtcgcatctacctgccgcccgtgctgcgcgccgagaagaagctcgcc
acgctggtccgcaccctgctcgccacgccccccggcggcgacgagtggacggtcacggtg
ggcgcggaggtcggcctctcggacgagcaggccagcgtgctgcatctcatggaagagcac
cggctggtcgtgctgaccggcggccccggtaccggcaagagcacgaccacccgcgcggtc
gccgacctcgccgagtcgctggggctggaggtcgggctgtgcgcccccaccggcaaggcg
gcgcggcggctgggcgaggtgacgggccgcacggcgagcacggtccaccgcctgctgggc
tacggcccggcggggttccggcacaaccacctcgaacccgcaccctacgacctgctcatc
gtggacgaggtctcgatgatgggcgacggcctgatgctctcgctgctcgcggcggtgccg
ccgggcgcgcgggtgctgctcgtgggcgacaccgaccagcttccgccggtagacgccggg
ctgcccctgctggcgctggcacaggtggccccgaccgtcacgctgacgcaggtctaccgt
caggcggccgagaaccccatcatccgcgcggcgcacggcctgctgcacgcccgggccccc
gaatggggcgacccccgcctgaccctcaccgagaccgagccggacgtgggcgcgcgccgc
gtggccctgatggtgcgtgacctcggcggcccggcggcggtgcaggtgctcacgcccatg
cgcaaggggccgctgggtatggacgcattgaacgcgcagctccagagcctgttcaaccct
ggtgagggcggcgtgcgtatcgccgagggccacgcccgccccggcgacaccgtcgtgcag
accaagaacgactacaccaacgagatcttcaacggcacgctgggcacggtcctcaaggcc
gaggggggccgcctgacggtggatttcgacggcaatgtggtggacctcgcgggcgcggaa
ctgttcaacctgcaactcggctacgcgctgacggtccaccgcgcgcagggcagcgagtgg
ccgcaggtcctcggcgtgctgcacgaggctcacatgccgatgctctcgcgcaatctggtc
tacaccgccctgacgcgcgcccgcgaccgcttccatgccgccggctcggcttcggcctgg
gtgcgggcggcgggccgtcagcgcgaggcccgcaacacggcgctgctggaacgcatccag
acgaggtga

DBGET integrated database retrieval system