KEGG   Deinococcus gobiensis: DGo_CA1845Help
Entry
DGo_CA1845        CDS       T01827                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00900  Terpenoid backbone biosynthesis
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01130  Biosynthesis of antibiotics
Module
dgo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DGo_CA1845
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     DGo_CA1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXPR_C DXP_reductoisom RmlD_sub_bind EutK_C
Motif
Other DBs
NCBI-ProteinID: AFD25772
UniProt: H8GWW6
Position
1992494..1993672
Genome map
AA seq 392 aa AA seqDB search
MKLTVLGSTGSIGTQALDVARERGWVVGTLAAGRNLERLAEQVREFRPEVVSVDAAVYAQ
AREVLGAGLRGARLIADADEAAAQPADVVVNAMSGLIGLSPTRRALEAGRAVALATKEAM
VTAAHLMWEAAAVGGGRVVPVDSEHTGVYQCLTGEDMADVAEVILTASGGPFRDGPADLS
GVTPAQALKHPSWSMGPKVTIDSATLMNKGLEVMECASLYGLPLSQVGVVVHPQSLVHAA
VRFRDGSLKAQFGPTDMRLPIAYAIDAAPSGMQRPGDVRGARRGGEVAGHLGWPLRGEWQ
FRDPDPVRFPCLALAYRAGEAGGLAPVALNAADEVAVEAFLAGQIGFLDIPRLLERVLDE
TPAGALTWGSLAEADAWARTRSRELVGAGVRA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgacggttctgggcagcacgggaagcatcggcacacaggcgctggatgtggcg
cgcgaacgcggctgggtggtgggcaccctggcggcggggcgcaatctggagcgtctggcc
gagcaggtccgcgagttccggccggaagtggtcagcgtggacgccgccgtatacgcccag
gcccgcgaggtgctgggagccgggctgcgcggcgcgcgcctgatcgcggacgccgatgag
gccgccgcgcagcccgccgacgtggtcgtcaacgccatgagcggcctgatcggcctgtcg
cccacccgccgggcgctggaggcggggcgcgcggtcgccctggcgacgaaggaggcgatg
gtcacggccgcgcacctgatgtgggaggcggcggcggtcggcggcgggcgcgtggtgccg
gtggactcggagcataccggcgtgtaccagtgcctgaccggcgaggacatggccgacgtg
gccgaggtgatcctgaccgcctcgggcggccccttccgcgacggcccggccgacctgagc
ggcgtgacgcccgcgcaggccctcaagcacccctcgtggagcatggggccgaaggtgacc
attgacagcgccacgctgatgaacaaggggctggaggtcatggagtgcgccagcctctac
ggcctgccgctgtcgcaggtgggcgtggtcgtgcacccgcagagcctcgtgcacgcggcg
gtgcgtttccgcgacggcagcctcaaggcgcagttcgggccgaccgacatgcggctgccc
atcgcctacgccatcgacgcggccccgagcgggatgcagcggcccggcgacgtgcgcggc
gcgcgccggggcggcgaggtcgccgggcacctgggctggcccctgcgcggcgagtggcag
ttccgcgaccccgaccccgtacgctttccctgcctcgcgctggcctaccgcgcgggcgag
gcgggcggcctggcccccgtcgccctgaacgccgccgacgaggtggcggtcgaggccttc
ctggcgggccagatcggcttcttggacattccccggctgctggagcgcgtgctggacgag
accccggccggcgcgctgacctggggcagtctggccgaggccgacgcctgggcgcggacg
cgctcacgcgagctggtcggggcaggggtgcgcgcatga

DBGET integrated database retrieval system