KEGG   Deinococcus gobiensis: DGo_CA2078Help
Entry
DGo_CA2078        CDS       T01827                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
dgo  Deinococcus gobiensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DGo_CA2078 (recR)
DNA repair and recombination proteins [BR:dgo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      DGo_CA2078 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2209899..2210513
Genome map
AA seq 204 aa AA seqDB search
MKYPPSLVALIRELSRLPGIGPKSAQRLAFHLFEQPREDIERLASALLSAKRDLHTCPIC
FNITDAETCDVCSDPSRDQNLIAVVEEPGDVIAIERSGEYRGLYHVLHGVLSPMNGVGPE
KLHIRPLLPRVREGMEVILATGTTVEGDATALYLQRLLEPLGAAVSRIAYGLPVGGALEY
ADEVTLGRALTGRQRVGGPVAGKG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaataccccccctcgctggtcgcgctgatccgtgaactctcgcgcctgccgggcatc
ggccccaagagcgcgcagcgcctggccttccacctgttcgagcagccgcgcgaggacatc
gagcgcctcgcctcggcgctgctgtcggccaagcgcgacctgcacacctgccctatctgt
ttcaacatcaccgacgccgagacctgcgacgtgtgcagcgacccctcgcgcgaccagaac
ctgatcgcggtggtcgaggaacccggcgacgtgatcgccatcgagcgcagcggcgagtac
cgggggctgtaccacgtgctgcacggcgtcctgagcccgatgaacggggtcggtcccgag
aagctgcacatccggcccctgctgccacgcgtgcgtgagggcatggaggtcatcctggcg
accggcaccacggtcgagggcgacgccactgccctgtacctgcaacggctgctcgagccg
ctgggcgcggccgtgagccgcatcgcctacggcctgccggtgggcggcgcgctggaatac
gccgacgaggtcacgctgggccgcgccctgaccggccgccagcgggtcggtggcccggtg
gccggcaagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system