KEGG   Deinococcus gobiensis: DGo_CA2667Help
Entry
DGo_CA2667        CDS       T01827                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_CA2667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_CA2667
   00052 Galactose metabolism
    DGo_CA2667
   00500 Starch and sucrose metabolism
    DGo_CA2667
   00520 Amino sugar and nucleotide sugar metabolism
    DGo_CA2667
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DGo_CA2667
   00524 Butirosin and neomycin biosynthesis
    DGo_CA2667
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DGo_CA2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2818277..2819188
Genome map
AA seq 303 aa AA seqDB search
MTTGQTAAEQISIGVDVGGTKIACGVLRGEQLLERHVQPTPDTGWEGVLDAIAAQVKALQ
AAQPGARLIGVGVPGPLNADRTRVKFAPNIYGFTDVPLVDGLRERLGLRIVLENDAKAAA
LAEAHLGAARGTESSVYVTVSTGIGAGLVLNGRLWRGRHGIAGEIGHITVMPGGPVSGAG
LDGALEAVASGTAIARDASYALNRDVSTAEAFSLAEQGHPAARRVVAQALRHIGTALADL
QKTLDPEVFVIGGGVASVGDYFFQGVQRAADEYSQGFAPVTIRRAQLGTDAGVIGAALAA
RHG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacaggacagacggcagcggagcagatcagcatcggggtggacgtgggcggcacc
aagatcgcctgcggggtcctgcggggcgagcagcttctggaacgccacgtgcagcccacg
cccgataccggctgggagggcgtgctggacgccatcgccgcgcaggtcaaggccctccag
gccgcgcagcccggggcccgcctcatcggggtgggggtgccgggaccgctgaacgccgac
cgcacccgcgtcaagttcgcgcccaacatctacggctttaccgacgtgccgctggtggac
ggcctgcgcgagcggctgggcctgcgcatcgtcctggaaaacgacgccaaggccgccgcc
ctggccgaggcgcacctgggcgcggcgcgcggcaccgagagcagcgtgtacgtgacggtc
agcaccggcatcggcgcggggctggtcctgaacgggcggctgtggcgcggtcgccacggc
atcgcgggcgagatcgggcacatcacggtcatgcccggcggccccgtgagcggcgcgggc
ctggacggcgcgctggaagcggtcgccagcggcacggccatcgcgcgcgacgcgagctac
gccctgaaccgcgacgtgagcaccgccgaggccttctcgctggccgagcagggccacccc
gccgcgcggcgcgtggtcgcgcaggcgctgcggcacatcggcacggcgctggccgacctg
caaaagaccctcgacccggaggtcttcgtgatcggcgggggggtcgccagcgtgggcgac
tacttcttccagggcgtgcagcgcgccgccgacgagtactcgcagggcttcgcgcccgtc
accatccgccgcgcgcagctcggcaccgacgcgggcgtgatcggcgccgcactcgccgcc
cggcacggctga

DBGET integrated database retrieval system