KEGG   Deinococcus gobiensis: DGo_CA2732Help
Entry
DGo_CA2732        CDS       T01827                                 

Gene name
folE
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dgo  Deinococcus gobiensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DGo_CA2732 (folE)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DGo_CA2732 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2889015..2889581
Genome map
AA seq 188 aa AA seqDB search
MPGLSGLTRDWLSAIGEDPEREGLERTPHRVAKAWSYLTSGYEQTLQSVVGEGVFASEGS
EMVIVKDIEFYSMCEHHMLPFYGRAHVAYIPEGRILGLSKFARIVDLYSRRLQVQERITT
QIADAVQDLLAPQGVAVLMEGVHLCMAMRGVQKQNSSTTTSAMRGLFRSDARTRAEFMSA
VQGTLRGR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggcctgagcggcctgacccgcgactggctttcggccatcggggaagacccggag
cgcgagggcctggagcgcacgccccaccgcgtcgccaaggcctggagctacctgacctcc
ggctacgagcagaccctccagagcgtggtgggcgagggcgtcttcgcgtccgagggcagc
gagatggtgatcgtcaaggacattgagttctactcgatgtgcgagcaccacatgctgccc
ttctacggccgcgcccacgtcgcctacattcccgagggcaggattctgggcctgagcaag
ttcgcccgcatcgtggacctgtactcgcgccgcctccaggtccaggagcggatcacgacc
cagatcgcggacgccgtgcaggacctgctcgcgccgcagggcgtggccgtcctgatggaa
ggggtgcacctgtgcatggcgatgcgcggcgtgcagaaacagaattccagcacgaccacc
tcggccatgcgtgggctgttccgcagcgacgcccgcacccgcgccgagttcatgagcgcg
gtccagggcaccctgcgcggacgctga

DBGET integrated database retrieval system