KEGG   Deinococcus gobiensis: DGo_CA2792Help
Entry
DGo_CA2792        CDS       T01827                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00900  Terpenoid backbone biosynthesis
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01130  Biosynthesis of antibiotics
Module
dgo_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DGo_CA2792 (ispE)
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     DGo_CA2792 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N DUF3396
Motif
Other DBs
NCBI-ProteinID: AFD26719
UniProt: H8GV44
Position
complement(2966110..2966904)
Genome map
AA seq 264 aa AA seqDB search
MVGRRADGYHELHTLMVPLTVGDTLDIAPAPGLSLRVEGADLPADGRNLVYRAARAYLDA
AGVTQGAAITLHKRLPLASGLGGGSSDAATTLLALARLYPCGVDLPALALTLGADVPFFL
PGGAALASGVGEVLQPVDLPPVPLVLLNPGVEVSAADAYRWLAGRFTSPLDLEALLAALA
SGEPVPYFNALQPEVVRRHPPIAGALAALQGAGLHSPLMSGSGSTCFALARSEAQAQEAA
RQLAARFPGWWVAAASTRSQAPRG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggccgccgcgccgacggctaccacgagctgcataccctgatggtgcccctgacg
gtgggcgacacgctcgacatcgccccggcccccgggctgagcctgcgggtcgagggggcc
gacctcccggccgacggccgcaacctcgtgtaccgcgcggcgcgggcctacctggatgcg
gcgggagtgacgcaaggcgcggcgatcaccctgcacaaacgcctgccgctcgcctcgggc
ctgggtgggggcagcagcgacgcggcgaccacgctgctcgccctggcgcggctctacccg
tgcggggtggacctgccggccctggcgctgaccctcggggccgacgtgcccttcttcctg
ccggggggcgcagcgctggcctcgggggtgggtgaggtcttgcagccggtggacctgcct
cccgtgccgctggtgctgctcaaccccggggtggaggtcagcgccgccgacgcctaccgc
tggctggccgggcgcttcacgtccccgctggacctggaggccctgctggcggcgctggcg
tcgggcgagccggtgccgtacttcaacgccctgcaacccgaggtcgtgcgccgccacccg
cccatcgccggggcgctcgcggccctgcaaggcgcgggcctgcactcgccgctgatgagc
ggttcgggaagcacctgtttcgccctggcccgcagcgaggcccaggcgcaggaggcggcc
cggcagctcgccgcgcgctttccaggctggtgggtggcggcggcctctacccgaagccaa
gcccccagagggtga

DBGET integrated database retrieval system