KEGG   Deinococcus gobiensis: DGo_CA2802Help
Entry
DGo_CA2802        CDS       T01827                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dgo  Deinococcus gobiensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dgo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2979520..2979885)
Genome map
AA seq 121 aa AA seqDB search
MGGPPGQPDYLNAALRLDTDLTAAALLAALHAAEARAGRERSRRWEARVLDLDLILYGDQ
VSGDPALTLPHPRAWERAFVLAPLADLDPALPHPVTGETAAQALARVGPGGIEQVSPTWT
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgggccgcctggtcagcccgactacctgaacgcggcgctgcggctggacaccgac
ctgaccgctgcggccctgctcgcggccctgcacgccgccgaggcccgcgcgggccgcgaa
cgctcgcggcgctgggaggcgcgggtgctcgacctcgacctgatcctgtacggagatcag
gtctccggggacccggcccttaccctgccgcatccccgcgcctgggagcgcgctttcgtc
cttgctcccctggccgatctcgatccggccttgccccatccggtaacgggggagaccgcc
gcgcaggccctcgcgcgggtggggccggggggaatagagcaggtatctccgacttggacg
caatga

DBGET integrated database retrieval system