KEGG   Deinococcus gobiensis: DGo_CA2802Help
Entry
DGo_CA2802        CDS       T01827                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dgo  Deinococcus gobiensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DGo_CA2802 (folK)
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     DGo_CA2802 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2979520..2979885)
Genome map
AA seq 121 aa AA seqDB search
MGGPPGQPDYLNAALRLDTDLTAAALLAALHAAEARAGRERSRRWEARVLDLDLILYGDQ
VSGDPALTLPHPRAWERAFVLAPLADLDPALPHPVTGETAAQALARVGPGGIEQVSPTWT
Q
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgggccgcctggtcagcccgactacctgaacgcggcgctgcggctggacaccgac
ctgaccgctgcggccctgctcgcggccctgcacgccgccgaggcccgcgcgggccgcgaa
cgctcgcggcgctgggaggcgcgggtgctcgacctcgacctgatcctgtacggagatcag
gtctccggggacccggcccttaccctgccgcatccccgcgcctgggagcgcgctttcgtc
cttgctcccctggccgatctcgatccggccttgccccatccggtaacgggggagaccgcc
gcgcaggccctcgcgcgggtggggccggggggaatagagcaggtatctccgacttggacg
caatga

DBGET integrated database retrieval system