KEGG   Deinococcus gobiensis: DGo_CA2804Help
Entry
DGo_CA2804        CDS       T01827                                 

Gene name
folP
Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dgo  Deinococcus gobiensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dgo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980381..2981178)
Genome map
AA seq 265 aa AA seqDB search
MRRWSGCGVMGVLNVTPDSFSDGGLHTRLTAALASARQMRDRGALMLDIGGESTRPGAAP
VEAAEELDRVLPLVRALRTEGILLSVDTMKPEVAAEALRAGAHLVNDVRGLRDPEMRRVC
AEAGAAACIMHMQGEPRTMQRRPEYGDVVAEVHAFLRAQASLAEAEGVPSVLLDPGLGFG
KTLDHNLALLRATAGLAAGPWPVLVAASRKRMIDTLAGVPEAAERDPGSLALHLDAARRG
AALVRAHAAGAHVQALRVQAAVLEG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgctggtccggctgcggcgtcatgggggtcctgaacgtcacgcccgacagtttc
agcgacgggggcctgcatacccgcctgacggcggcgctcgcctcggcccggcagatgcgc
gaccggggggcgctgatgctggacatcgggggggaaagtacccgcccaggcgcggcgccg
gtggaagcggccgaggaactcgaccgggtcctgccgctggtgcgggcgctgcgtaccgag
gggattctgctgagcgtggacaccatgaagccggaagtcgcggccgaggcgctgagggcg
ggagcgcatctggtcaacgacgtgcggggcctgcgggaccccgagatgcgccgggtgtgc
gccgaggcgggcgcggccgcgtgcatcatgcacatgcagggcgagccccgcaccatgcag
cggcggcccgagtacggcgacgtggtggcggaagtccacgccttcctgcgcgcccaggcg
agtctggccgaggccgagggggtgccgtcggtcctgctggaccctggcctgggcttcggc
aagacgctggaccacaacctggccctgctgcgcgcgaccgccgggctggcggctggaccc
tggccggtgctcgtggccgcgagccgcaagcgcatgatcgacacgctggccggagttccg
gaagcggcggagcgtgatcccggcagcctcgcccttcacctcgacgcggcccggcgcggc
gcggcgctggtccgggcccacgcggcgggcgcgcacgtccaggccctgcgggtgcaggcg
gccgtgctggagggctag

DBGET integrated database retrieval system