KEGG   Deinococcus gobiensis: DGo_CA2851Help
Entry
DGo_CA2851        CDS       T01827                                 

Definition
(GenBank) Endoglucanase, putative
Organism
dgo  Deinococcus gobiensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3026355..3027323
Genome map
AA seq 322 aa AA seqDB search
MWKKEAATFARVSEDHYGNVYAELGPEDAPAVALMGHLDEIGLIVSYVGDEGFLSVLPVG
GWDPQVLVGQRIRLLAPGGDLIGVIGKKAIHVMDADERTKASKLEDLWIDVGLSKEEAQA
QIPVGTYGVIEQGPVMVGGKVVSRALDNRVGAFIVLEALRALKDTDLKHRVVAVGTTQEE
IGLFGAQLSGHRLDPIAGIAVDVTHETRQPGVSEKKYGVAPFGSGANLTVGPMQSPALLR
RLTDAAKAEGIPYTLSATGRYSGTDADALALVRSGVPTAVVSIPNRYMHSPSEMVDERDV
KACTDIIAAGVRALEAQPDFGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaaaaggaggccgcgaccttcgcccgcgtgagcgaggaccactacggcaacgtg
tacgccgaactcggccccgaggacgcgcccgccgtcgccctgatgggccacctcgacgag
atcggcctgatcgtctcctacgtcggcgacgagggcttcctgagcgtgctgccggtgggc
ggctgggacccgcaggtgctcgtgggccagcgcatccggctgctcgcgcccggcggcgac
ctcatcggcgtgatcggcaagaaggcgattcatgtcatggacgccgacgagcgcaccaag
gccagcaagctcgaggacctgtggatcgacgtgggcctgagcaaggaagaggcccaggcg
cagattccggtcggcacctacggcgtcatcgagcaggggccggtcatggtgggcggcaag
gtggtcagccgcgcgctcgacaaccgcgtgggcgcgttcatcgtgctcgaagccctgcgg
gcgctgaaggacaccgacctcaagcaccgcgtggtcgccgtgggcaccacccaggaggag
atcgggctgttcggcgcgcagctcagcgggcaccgtctggaccccatcgccggcatcgcc
gtggacgtgacgcacgagaccaggcagcccggcgtgagcgagaagaagtacggcgtggcc
cccttcggctcgggcgcgaacctgacggtcgggccgatgcagagccccgccctgctgcgc
cgcctgaccgacgccgcaaaggccgagggcattccctacaccctctcggccaccgggcgc
tacagcggcaccgacgccgacgcgctggcgctggtgcgctcgggcgtgccgaccgccgtg
gtcagcattcccaaccgctacatgcacagccccagcgagatggtggacgagcgcgacgtg
aaggcctgcaccgacatcatcgcggcgggcgtgcgcgcgctggaggcgcagccggacttc
gggcgctga

DBGET integrated database retrieval system