KEGG   Deinococcus gobiensis: DGo_CA2851Help
Entry
DGo_CA2851        CDS       T01827                                 

Definition
Endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
dgo  Deinococcus gobiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DGo_CA2851
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     DGo_CA2851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3026355..3027323
Genome map
AA seq 322 aa AA seqDB search
MWKKEAATFARVSEDHYGNVYAELGPEDAPAVALMGHLDEIGLIVSYVGDEGFLSVLPVG
GWDPQVLVGQRIRLLAPGGDLIGVIGKKAIHVMDADERTKASKLEDLWIDVGLSKEEAQA
QIPVGTYGVIEQGPVMVGGKVVSRALDNRVGAFIVLEALRALKDTDLKHRVVAVGTTQEE
IGLFGAQLSGHRLDPIAGIAVDVTHETRQPGVSEKKYGVAPFGSGANLTVGPMQSPALLR
RLTDAAKAEGIPYTLSATGRYSGTDADALALVRSGVPTAVVSIPNRYMHSPSEMVDERDV
KACTDIIAAGVRALEAQPDFGR
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtggaaaaaggaggccgcgaccttcgcccgcgtgagcgaggaccactacggcaacgtg
tacgccgaactcggccccgaggacgcgcccgccgtcgccctgatgggccacctcgacgag
atcggcctgatcgtctcctacgtcggcgacgagggcttcctgagcgtgctgccggtgggc
ggctgggacccgcaggtgctcgtgggccagcgcatccggctgctcgcgcccggcggcgac
ctcatcggcgtgatcggcaagaaggcgattcatgtcatggacgccgacgagcgcaccaag
gccagcaagctcgaggacctgtggatcgacgtgggcctgagcaaggaagaggcccaggcg
cagattccggtcggcacctacggcgtcatcgagcaggggccggtcatggtgggcggcaag
gtggtcagccgcgcgctcgacaaccgcgtgggcgcgttcatcgtgctcgaagccctgcgg
gcgctgaaggacaccgacctcaagcaccgcgtggtcgccgtgggcaccacccaggaggag
atcgggctgttcggcgcgcagctcagcgggcaccgtctggaccccatcgccggcatcgcc
gtggacgtgacgcacgagaccaggcagcccggcgtgagcgagaagaagtacggcgtggcc
cccttcggctcgggcgcgaacctgacggtcgggccgatgcagagccccgccctgctgcgc
cgcctgaccgacgccgcaaaggccgagggcattccctacaccctctcggccaccgggcgc
tacagcggcaccgacgccgacgcgctggcgctggtgcgctcgggcgtgccgaccgccgtg
gtcagcattcccaaccgctacatgcacagccccagcgagatggtggacgagcgcgacgtg
aaggcctgcaccgacatcatcgcggcgggcgtgcgcgcgctggaggcgcagccggacttc
gggcgctga

DBGET integrated database retrieval system