KEGG   Deinococcus gobiensis: DGo_PA0122Help
Entry
DGo_PA0122        CDS       T01827                                 

Definition
Polyphosphate glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_PA0122
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_PA0122
   00520 Amino sugar and nucleotide sugar metabolism
    DGo_PA0122
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     DGo_PA0122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:143683..144420
Genome map
AA seq 245 aa AA seqDB search
MSRAAHAVLSVDIGGTHVKALLSGHPHSGARRFDSGPDLTPAEMVRGVLALCAAGPVWTF
GAVSVGYPGPVLHGQPVRDPAHLGPGWVGFDFAGAFGRPLKLVNDAAMQALGSYAGGKML
FLGLGTGLGSALIVDGIAEPLELAHLPYRKHTFEDYVGLRGLKKHGKKKWRRQVLDVIAE
LSAALEPDTVVLGGGNAKLFADHLDDLPPQVRLGDNANAFTGGFRLWDDKARPQPAPART
PPETP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcgcggcgcacgcggtcctgagcgtggatatcggcggcacgcacgtcaaggcg
ctgctcagcggccacccccacagcggggcgcggcgcttcgactccggccccgacctgacg
cccgccgagatggtccggggcgtgctggccctgtgcgcggccgggccggtctggaccttc
ggcgccgtgagtgtgggctatccggggccggtgctgcacggccagccggtacgcgacccc
gcccatctggggccgggctgggtgggcttcgacttcgcgggcgccttcgggcggcccctc
aagctcgtcaacgacgcggccatgcaggcgctcgggagctacgcgggcggcaagatgctg
ttcctgggcctgggcacggggctgggcagcgccctgatcgtggacggcatcgccgaaccg
ctggaactggcgcatctcccctaccgcaagcacaccttcgaggactacgtgggcctgcgg
ggcctgaaaaagcacggcaagaagaagtggcgccgtcaggtgctggacgtgatcgcggaa
ctgagcgccgccctggagcccgacacggtggtgctgggcgggggcaacgccaagctgttc
gcggaccatctcgacgacctgcccccgcaggtcaggctgggcgacaacgccaacgccttc
acgggcggcttccggctgtgggacgataaggccagaccgcagcctgcccccgcccgcacc
ccgccggagaccccgtga

DBGET integrated database retrieval system