KEGG   Deinococcus gobiensis: DGo_PA0123Help
Entry
DGo_PA0123        CDS       T01827                                 

Definition
glucan 1,3-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
dgo  Deinococcus gobiensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dgo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:144618..146816
Genome map
AA seq 732 aa AA seqDB search
MTFYLVMDGQEGPGGAVQGWVDLKRAAAYSLGVPAPHLPLPTVIHSGTHAGADYRLTLEV
LPDPQRDALLVRYALDGPFRLVVIAAPHLGGTGQDNVAWVDGALFAHHAGHVLCLSATGP
LRRASAGVVGVSDGWQDLQAHGRLTWAYTRAGPGNVALSAELEDRAGTLALGFSNTARGA
WTLARGALAEGYGAAEQEFLRGWGVWGDALKLPAPDPALGQLALLSAAVLKMHEDRTYPG
AIVASLSVPWGDSTDTLGGYHLVWPRDATLAAFALIAAGTPGDARRVLARFLATQQPDGH
WLQNTYPSGDPFWTGLQLDETAFPVLLAAKLREEGLEDLPGTAEMVGRALGFVVRTGPTS
DQDRWEENPGVNPFTLAVAVAALAAGAMWLPEAEREEALKVADEWNERLESWCYVQDTPL
AQELEVGGYYVRLAPPQRDGGLGGTVLLRNRMGETIGASALVSLDFSYLTRLGLRQADDP
RIVDTLKVVDHVLRVPTPSGDLYHRYNDDGYGEHEDGRPFDGSGIGRLWPLLSGERGHLA
LLSGEDPLPYLRTIAACASPGGLLPEQVWDAAPIPERGLYPGRPSGSAMPLVWTHAEFLK
LLLARETGRPAELLRAVGDRYARPRDAAEWRWRNETPLRQLPPGRDLTFESPVAFTLHFG
WDGWQDVQERQAQCGTFGLWLLTFRAEELRAHGSLNFTRRFGEAWEGADHEIRLERGAAR
EVTADQPDAARS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacgttctatctggtcatggacgggcaggagggcccgggcggcgccgtccagggctgg
gtggacctcaaacgcgcggcggcctatagcctgggcgtgcccgcgccgcacctgccgctg
cccaccgtgatccacagcggcacgcacgccggggccgactaccgtctgacgctggaggtg
ctgcccgacccgcagcgcgacgccctgctcgtccgctacgcgctcgacggccccttccgg
ctcgtggtgatcgccgcgccgcacctggggggcaccggccaggacaacgtggcctgggtg
gacggcgcgctgttcgcccaccacgcgggccacgtgctgtgcctgagcgccaccgggccg
ctgcgccgcgcttcggcgggggtggtgggcgtgtccgacggctggcaggacctgcaggcc
cacgggcggctgacctgggcctacaccagggccggccccggcaacgtggccctgagcgcc
gagctggaagaccgcgccggcacgctggccctgggcttctcgaacacggcgcgcggggcc
tggaccctggcgcgcggcgcgctggccgaagggtacggggccgccgagcaggagttcctg
cggggctggggcgtctggggcgacgcgctgaagctgccggcccccgatcctgccctgggg
cagctcgccctgctcagcgccgccgtcctcaagatgcacgaggaccgcacctaccccggc
gccatcgtcgccagcctcagcgtgccctggggcgactcgaccgacacgctggggggctac
cacctggtctggccgcgagacgcgacgctggccgccttcgccctgatcgcggcgggcacg
cccggagacgcccggcgcgtcctggcgcgctttctcgccacgcagcagccggacggccac
tggctgcagaacacctaccccagcggcgaccccttctggaccgggctgcaactcgacgag
accgcctttccggtcctgctggccgccaaactgcgtgaagaaggcctggaggacctgccc
ggcaccgccgagatggtgggccgcgccctgggcttcgtggtgcgcaccggcccgaccagc
gaccaggaccgctgggaggaaaaccccggcgtgaacccgttcacgctggccgtcgccgtc
gcggcgctggcggcgggggccatgtggttgccggaggccgagcgcgaggaggccctgaag
gtggccgacgagtggaacgagcgcctggaaagctggtgctatgtccaggacacgccgctg
gcgcaagagctggaggtggggggctactacgtgcgcctggcgcccccgcagcgcgacggt
gggctgggcggcacggtgctgctgcgcaaccgcatgggcgagaccatcggcgcgtcggcc
ctggtcagcctggatttctcgtacctgacccgcctggggctgcggcaggcggacgacccg
cgcatcgtggacacgctgaaggtggtggaccatgtgctgcgtgtcccgacccccagcggc
gacctctaccaccgttacaacgacgacggttacggcgaacacgaggacggccgccctttc
gacggctcgggcatcgggcggctgtggccgctgctgtcgggcgaacgcgggcacctcgcg
ctgctgtcaggcgaggacccgctgccctacctgcggaccatcgcggcctgtgccagtccc
ggcggcctgctgcccgagcaggtctgggacgcggcccccatcccggagcgcggcctgtat
ccggggcggccctcaggcagcgccatgccgctggtgtggacccacgccgaattcctgaag
ttgctgctggcgcgtgaaacaggccgccccgccgagctgctgcgggcggtcggggaccgc
tatgcccggcccagggacgccgccgagtggcgctggcgcaacgagacgccgctgcgccag
ctgccgccggggcgcgacctgaccttcgagagtccggtggccttcacgctccacttcggc
tgggacggctggcaggacgtgcaagagcgtcaggcgcagtgtggcaccttcggcctgtgg
ctgctgaccttccgggccgaggaactgcgcgcgcacggcagcctgaatttcacccggcgc
ttcggggaggcctgggagggagccgaccacgaaatccggctggagcgcggcgcggccagg
gaggtcacggcagaccagccggacgcggcgcgcagctga

DBGET integrated database retrieval system