KEGG   Deinococcus gobiensis: DGo_PA0148Help
Entry
DGo_PA0148        CDS       T01827                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
dgo  Deinococcus gobiensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DGo_PA0148
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     DGo_PA0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:170282..171004
Genome map
AA seq 240 aa AA seqDB search
MGDDPYAGVLRGSLRESGVQDLSLTLPLPTGAAFITVAESGENVIAVASGANAGLTPEQR
PPLEGATVLVLQLEIPLETVQAYARAARERDIRVILNAAPATALSAALLADVDVLVVNEG
ELDTLSGPGSQPGDLEGQLRRVQAQGPRTVLVTLGGEGSAALSGEDLIRVPAPAVTVLDS
TGAGDTYVGVLAGALGGGEPLERAMRRATVAASLACTREGAQPSMPSRDEIERGLTGERA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgacccctacgccggcgttctgcgcggctcgctgcgggaaagcggcgtgcag
gacctcagcctgacgctgccgctgcccaccggcgcagccttcatcaccgtggccgagtcc
ggcgagaacgtgatcgccgtcgcctcgggggccaacgcgggcctgacccccgagcagcgg
ccgcccctggagggcgccaccgttctcgtgctgcaactcgaaattcctctggagaccgtg
caggcctacgcccgcgccgcccgggaacgggacatccgggtgatcctgaacgccgcgccc
gccaccgcactgagcgccgcactgctggccgacgtggacgtgctggtggtcaacgagggc
gagctggacacgctgagcggccccggcagccagccgggcgacctcgaaggccagctgcgc
cgcgtgcaggcccagggcccccgcacggtgctggtcacgctgggcggcgaaggcagcgcc
gcgctgagcggcgaggacctgatccgtgtgcctgcgcccgccgtgacggtgctcgactcg
accggcgcgggcgacacctacgtcggcgtgctggccggagcactggggggcggcgagccg
ctggagcgggcgatgcgccgggcgaccgtggcggcctcgctggcctgcacccgcgagggc
gcgcagcccagcatgcccagccgcgacgagatcgagcgcggcctgaccggagagcgggca
tga

DBGET integrated database retrieval system