KEGG   Deinococcus gobiensis: DGo_PA0164Help
Entry
DGo_PA0164        CDS       T01827                                 

Definition
Beta-galactosidase family
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dgo  Deinococcus gobiensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DGo_PA0164
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     DGo_PA0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:186928..188928
Genome map
AA seq 666 aa AA seqDB search
MSSLPPSDSLPFLSLGVCDYPEHVPQPLWAGYARDQKALGLEFVRLAEFAWSRMEPRPGE
YDWAWLDEAVETSAAAGLKVVLCTPTAAPPAWLVEAHPEILPVGRDGQVKSFGSRRHYDF
SSAVYREHSRRITRAVAERYGRHPAVVGWQTDNEFGWGDTAQSFSPAVHAAFHAWLERRY
GTVDALNAAWGNVFWSMDYSGWAQVPLPHHAVSEINPAHALDFLRFSSGEVAAFQAEQVA
LLREHSPGRFVTHNYMGFFSAYDHYEVSRGLDFASWDSYPTGTLQAIHEWKLLAPHFALD
YARTGHPDVTAFNHDLYRGMVTPGAGQATPSFWVMEQQCGQVNWASANPLPAPGAVALWT
EQAWAHGADAVSYFRWRAATVGQEVLHSGLLRHSGRPDQGHREVAALRPQALPLAPTRAR
VALLHDYESLWLYNLQPHSEGLNYWAQTFTYYRALRALGVDVDILHPDRDLSGYAVVVAP
ALTLMTPERAAHLTASAGHSRLVFGPRTAFRTAAGGTPETGQFGDLAGLIGAELSRYDSL
YAGMTQDVEGEGGARHSAHAWAESYDLAGAEALWHYRGGPLDGEAAVVRHGAVTTVGAHS
ESLVRGVLRGALREAGVETAELPEGVRLTRRGPHTLLQNWTGESVHWQGRTLAPYSSALL
PQEVMA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccttcccccttccgattcccttccgttcctgtcgctgggcgtctgcgactac
cccgaacacgttccccagccgctgtgggccggctacgcccgcgaccagaaggcgctgggc
ctggagttcgtgcgcctggccgagttcgcctggagccgcatggaaccgcgccccggcgag
tacgactgggcctggctcgacgaggcggtcgagacctcggcggcggccgggctgaaggtc
gtgctgtgtacccccaccgccgcgccgcccgcctggctggtcgaggcgcaccccgagatc
ctgccggtgggccgcgacgggcaggtcaagagcttcgggtcgcggcggcactacgacttt
tccagcgccgtgtaccgtgagcattcgcggcgcatcacgcgggccgtcgcggaacgctac
ggccggcaccccgccgtcgtcggctggcagaccgacaacgagttcggctggggcgacact
gcccagagtttcagcccggcggtgcacgcggccttccacgcctggctggagcggcgctac
ggcacggtagacgccctgaacgcggcctggggcaacgtgttctggagcatggactacagc
ggctgggcacaggtgcccctcccccaccacgccgtctccgagatcaatccggcgcacgcg
ctggacttcctgcgcttttcgagcggcgaggtcgccgccttccaggccgagcaggtcgcc
ctgctgcgcgagcactcgccgggccggttcgtcacgcacaattacatgggctttttcagc
gcctacgaccactacgaggtctcgcgcgggctggatttcgcgagctgggacagctacccg
accggcaccctccaggccatccacgagtggaagctgctggccccgcacttcgccctggac
tatgcccgcaccggccacccggacgtcaccgccttcaaccacgacctctaccggggcatg
gtgacccccggcgcggggcaggccacccccagcttctgggtcatggagcagcagtgcgga
caggtgaactgggcgagcgcgaacccgctgccggcccccggcgccgtggccctctggacc
gagcaggcctgggcgcacggcgcggacgcggtgagctacttccgctggcgggccgccacg
gtgggccaggaggtcctgcactcgggcctgctgcgccacagcggccgccccgaccagggc
caccgcgaggtcgcggcgctgcggccccaggcccttcccctggcccccacccgggcgcgc
gtggccctgctgcacgactacgagagcctgtggctctacaacctgcaaccccacagcgag
ggcctgaactactgggcgcagaccttcacgtactaccgcgcgctgcgggcactgggggta
gacgtggacatcctgcacccggaccgcgacctgagcggctacgccgtggtcgtggcgccg
gccctcacgctgatgacgccggagcgcgcggcgcacctcacggcgagcgccgggcacagc
cgcctggtcttcgggccgcgcacggccttccggacggccgccgggggcacgcccgagacg
gggcagttcggagacctcgccggcctgatcggggccgaattgagccgttacgacagcctg
tatgccggcatgacgcaggacgtggagggtgagggcggcgcgcggcacagtgcccacgcc
tgggccgagagctacgacctcgcgggcgcggaggcgctgtggcactaccggggcggacca
ctggacggtgaggccgccgtcgtccggcacggcgcggtgacgaccgtcggggcacacagc
gagtcgctcgtgcgcggcgtactgcgcggcgcgctgcgcgaggcgggcgtggagacggcc
gagctgcccgaaggcgtacgcctcacgcggcgcggcccgcacaccctgctccagaactgg
accggcgagagcgtgcactggcagggccggaccctcgccccctacagcagcgccctgctg
ccccaggaggtcatggcatga

DBGET integrated database retrieval system