KEGG   Deinococcus gobiensis: DGo_PA0216Help
Entry
DGo_PA0216        CDS       T01827                                 

Definition
Uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dgo  Deinococcus gobiensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DGo_PA0216
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    DGo_PA0216
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     DGo_PA0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:253748..255148
Genome map
AA seq 466 aa AA seqDB search
MSPHPSPTPRPLADLNALSEDAFARHFAGVLEHSPHYARVAARQRPFADAEAAARAFMDA
ACSGTPEEQLALIRAHPDLAGKAALAGELTAESAGEQASAGLDRLSPEEYAEFGRLNAAY
HEKFGLPYVVCVRENDKASIFAGARRRLEHTPEQEREAALREIGRIARLRVLDLITSRDM
SEAPRVKVRLGENNYGKADVQLFKVFRDTPRHEVRDVRVRVAMTGDFGAAHVDGDNTGLL
ATDTVRNTVYALAKTGFAGSVEEFGKELVRHFVAAGPRVQGAFAEFTEHLWSRIEVDGQG
HDHSFVRQMPKHTARVEGDGQTFRVTSGIEELYVLKTTRSGWAGYLLDEPYTTLPETTDR
VMATFVTARWEYAVAGCDYDDVWARAYRQIQETFTDHYSPSLQNTLYRLGEAVLDRCPEI
SRVWFQLPNKHHLPYNLARFGLENNGEIFHVDPEPYGLMEGWVERA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtccccccacccatcccccaccccccgacccctggccgacctcaacgccctgagcgag
gacgccttcgcgcggcacttcgccggggtgctggaacattcgccgcactacgcgcgcgtg
gcggcccggcagcggcccttcgccgacgccgaggccgccgcgcgcgccttcatggatgcc
gcgtgctcgggtacacccgaggaacagctcgcgctgatccgcgcgcacccggacctcgcg
ggcaaggcggcgctggcgggcgagctgaccgccgagagcgcgggcgagcaggcctcggcg
gggctcgaccgcctgagcccagaggaatacgccgagttcgggcgcctgaacgcggcctac
cacgagaagttcgggctgccctacgtggtatgcgtgcgcgagaacgacaaagccagcatc
ttcgcgggcgcgcgccgccgcctggagcacacgcccgagcaagaacgggaggccgcgctg
cgcgagatcgggcgcatcgcgcggctgcgggtgctggacctgataacatcccgcgacatg
agcgaagccccccgcgtgaaggtccggctcggcgagaacaattacggcaaggccgacgtg
cagctgttcaaggtgttccgggacacgccgcgccacgaggtccgcgacgtgcgggtgcgg
gtcgccatgaccggcgatttcggggccgcgcacgtggacggcgacaacaccggcctgctc
gccaccgacacggtgcgcaacaccgtctatgcgctcgccaagacggggttcgcgggcagc
gtcgaggagttcggcaaggaactcgtgcggcacttcgtggcggccgggccgcgcgtgcag
ggcgccttcgccgagttcaccgagcacctgtggtcgcgcatcgaggtggacgggcagggc
cacgaccattccttcgtgcgccagatgcccaagcacaccgcgcgggtcgagggcgacggc
cagaccttcagggtcacgtcggggatcgaggaactgtatgtcctcaagacgacccggagc
ggctgggccggctatctgctcgacgagccctacaccaccctgcccgaaacgaccgaccgc
gtcatggcgaccttcgtgaccgcgcgctgggagtacgccgtggccgggtgcgactacgac
gacgtgtgggcgcgcgcctaccggcagattcaggagaccttcaccgaccactactcgccc
agcctccagaacacgctgtaccgtctgggcgaggccgtgctggaccgctgccccgaaatt
tcgcgggtgtggtttcagttgcccaacaagcaccacctgccgtacaacctggcacgcttc
gggctggagaataacggcgagatcttccatgtggaccccgaaccctacggcctgatggaa
ggctgggtcgagcgcgcgtga

DBGET integrated database retrieval system