KEGG   Deinococcus gobiensis: DGo_PA0229Help
Entry
DGo_PA0229        CDS       T01827                                 

Gene name
aceB
Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dgo  Deinococcus gobiensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_PA0229 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DGo_PA0229 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    DGo_PA0229 (aceB)
Enzymes [BR:dgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DGo_PA0229 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:268555..269202
Genome map
AA seq 215 aa AA seqDB search
MDVDAMQAYAEALVRVCRRREAEAVGGTAAVAPDPQNPRPALDAVRVDKAREAAQGFTAA
WAGLPGLLGAVREGFADARPAALPRETPEQSLARLTTLPDAGPLPLVTMRDTLGLALDVF
AAWFAGRGVIVRAGRLEDTATAELARAQLWQWCRVGAALEGGKRLTPAWYLTERRALLPD
DHPAARLLDHLVLADAAPAYFPREAQRLGLGEYAP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggacgccatgcaggcctacgccgaggccctggtgcgcgtatgccgccgccgg
gaggccgaggccgtgggcggcacggcggcggtcgcgccggacccccagaacccccgcccc
gccctggacgccgtgcgggtcgacaaggcgcgcgaggcggcgcagggcttcacggccgcg
tgggccggcttgcccgggctgctgggcgcggtgcgggagggcttcgcggatgcccggccc
gccgcgttgccgcgcgagaccccggagcagagcctcgcgcggctcaccaccctgccggac
gcggggccgctgcccctggtgaccatgcgcgacacgctgggcctcgccctcgacgtgttc
gcggcgtggttcgcgggccggggcgtgatcgtacgcgccgggcggctggaggacaccgcc
accgccgaactcgcccgcgcgcagctctggcagtggtgccgggtgggggccgcgctggaa
ggtggcaagcgcctgacaccggcgtggtacctgaccgagcgccgcgccctgctccccgac
gaccaccccgccgcgcggctgctcgaccatctggtgctcgccgacgccgcgcctgcctac
tttccgcgcgaggcccagcggctgggtctgggagaatacgcgccgtga

DBGET integrated database retrieval system