KEGG   Deinococcus gobiensis: DGo_PA0229Help
Entry
DGo_PA0229        CDS       T01827                                 

Gene name
aceB
Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
dgo  Deinococcus gobiensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_PA0229 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DGo_PA0229 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    DGo_PA0229 (aceB)
Enzymes [BR:dgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DGo_PA0229 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:268555..269202
Genome map
AA seq 215 aa AA seqDB search
MDVDAMQAYAEALVRVCRRREAEAVGGTAAVAPDPQNPRPALDAVRVDKAREAAQGFTAA
WAGLPGLLGAVREGFADARPAALPRETPEQSLARLTTLPDAGPLPLVTMRDTLGLALDVF
AAWFAGRGVIVRAGRLEDTATAELARAQLWQWCRVGAALEGGKRLTPAWYLTERRALLPD
DHPAARLLDHLVLADAAPAYFPREAQRLGLGEYAP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggacgccatgcaggcctacgccgaggccctggtgcgcgtatgccgccgccgg
gaggccgaggccgtgggcggcacggcggcggtcgcgccggacccccagaacccccgcccc
gccctggacgccgtgcgggtcgacaaggcgcgcgaggcggcgcagggcttcacggccgcg
tgggccggcttgcccgggctgctgggcgcggtgcgggagggcttcgcggatgcccggccc
gccgcgttgccgcgcgagaccccggagcagagcctcgcgcggctcaccaccctgccggac
gcggggccgctgcccctggtgaccatgcgcgacacgctgggcctcgccctcgacgtgttc
gcggcgtggttcgcgggccggggcgtgatcgtacgcgccgggcggctggaggacaccgcc
accgccgaactcgcccgcgcgcagctctggcagtggtgccgggtgggggccgcgctggaa
ggtggcaagcgcctgacaccggcgtggtacctgaccgagcgccgcgccctgctccccgac
gaccaccccgccgcgcggctgctcgaccatctggtgctcgccgacgccgcgcctgcctac
tttccgcgcgaggcccagcggctgggtctgggagaatacgcgccgtga

DBGET integrated database retrieval system