KEGG   Deinococcus gobiensis: DGo_PA0229Help
Entry
DGo_PA0229        CDS       T01827                                 

Gene name
aceB
Definition
(GenBank) Malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00620  Pyruvate metabolism
dgo00630  Glyoxylate and dicarboxylate metabolism
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01200  Carbon metabolism
Module
dgo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DGo_PA0229 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    DGo_PA0229 (aceB)
Enzymes [BR:dgo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     DGo_PA0229 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AFD27115
UniProt: H8H063
Position
P1:268555..269202
Genome map
AA seq 215 aa AA seqDB search
MDVDAMQAYAEALVRVCRRREAEAVGGTAAVAPDPQNPRPALDAVRVDKAREAAQGFTAA
WAGLPGLLGAVREGFADARPAALPRETPEQSLARLTTLPDAGPLPLVTMRDTLGLALDVF
AAWFAGRGVIVRAGRLEDTATAELARAQLWQWCRVGAALEGGKRLTPAWYLTERRALLPD
DHPAARLLDHLVLADAAPAYFPREAQRLGLGEYAP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggacgccatgcaggcctacgccgaggccctggtgcgcgtatgccgccgccgg
gaggccgaggccgtgggcggcacggcggcggtcgcgccggacccccagaacccccgcccc
gccctggacgccgtgcgggtcgacaaggcgcgcgaggcggcgcagggcttcacggccgcg
tgggccggcttgcccgggctgctgggcgcggtgcgggagggcttcgcggatgcccggccc
gccgcgttgccgcgcgagaccccggagcagagcctcgcgcggctcaccaccctgccggac
gcggggccgctgcccctggtgaccatgcgcgacacgctgggcctcgccctcgacgtgttc
gcggcgtggttcgcgggccggggcgtgatcgtacgcgccgggcggctggaggacaccgcc
accgccgaactcgcccgcgcgcagctctggcagtggtgccgggtgggggccgcgctggaa
ggtggcaagcgcctgacaccggcgtggtacctgaccgagcgccgcgccctgctccccgac
gaccaccccgccgcgcggctgctcgaccatctggtgctcgccgacgccgcgcctgcctac
tttccgcgcgaggcccagcggctgggtctgggagaatacgcgccgtga

DBGET integrated database retrieval system