KEGG   Deinococcus gobiensis: DGo_PA0235Help
Entry
DGo_PA0235        CDS       T01827                                 

Gene name
bga
Definition
Glycoside hydrolase, family 42-like protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
dgo  Deinococcus gobiensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dgo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:complement(273659..275746)
Genome map
AA seq 695 aa AA seqDB search
MFDIKSFGGVIYGADYNPEQWPRDVWREDARLMNEAGVNLVSLGIFSWALLEPRPGEYDF
GWLDEVMDLLHEHGVGVNLATATASPPPWLSLKYPDSKPVTADGVRLEVGGRQLYCPSHA
AFREHVRALTRQIARRYAAHPALRMWHVNNEYGCHIDQCYCGLCAENFRAWLRGKYGTLD
ALNAAWGTAFWSQRYGDWAEIQPPRRAPTYPNPTQQLDWRRFSSDNILELYRLEVEVLRE
VTPEIPVTTNFLGFLPGLDYHKWAREEDVVSLDAYPDPSDAAPHLDAGMSYDLMRSLRGG
QRWILMEQAPSAVNWRQHNAPKRPGLMRVLNHQALAHGASGLMYFQWRASRAGAEKYHSG
MVQHVGPERSRVWREVRALGQELKSLSALTGASVRSRVAVMFDWDNWWALELDSKPSALK
LMPLVRKWYAALRGLGQNVDFVHPEADLGAYDVVALPNGYLLTAGAAGNLRAFVQGGGTL
LTGFFSGIVDEHEHVQLGGYPGLLRDVLGLWVEEWAPLQPGETTAVRLEGGEEVQATQWA
EVIHPDGAQVLATFTEDYYAGGAAVTRHAFGAGQAYYLGSDLPQYTLAGLLEGALRGAGV
PLCHVPEQLDLSVSTLDGAQVLHLLNVHPTRPLTLRLPEGGARLGGDDVSSQTVVLAPYA
AELIRFRGEVDLVAVQVLDQEPVADKRQAGLPVPG
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacatcaaatcctttggcggcgtcatctacggcgccgactacaaccccgagcag
tggccgcgcgacgtgtggcgcgaggacgcgcgactcatgaacgaggcgggcgtgaacctc
gtctcgctgggcatcttctcctgggcgctgctcgaaccccggcccggcgagtacgacttc
ggctggctcgacgaggtcatggacctgctgcacgaacacggcgtcggcgtgaacctggcg
accgccaccgcctcgccgccgccctggctgtcgctgaagtacccggactccaagcccgtg
accgccgacggcgtgcgcctggaggtgggcgggcggcagctctactgccccagccacgcc
gccttccgcgagcacgtgcgcgcgctgacgcgccagatcgcccggcgctacgccgcccac
cccgccctgcggatgtggcacgtgaacaacgagtacggctgccacatcgaccagtgctac
tgcgggctgtgcgccgaaaacttccgtgcgtggctgcgcggcaaatacggcaccctggac
gccctgaacgccgcctggggcaccgccttctggagccagcgctacggcgactgggcggag
atccagccgccgcgccgcgcgcccacctaccccaaccccacccagcagctcgactggcgg
cgcttttccagcgacaacatcctggagctctaccgcctggaggtagaggtgctgcgcgag
gtcacgccggaaattccggtcacgaccaacttcctgggctttctgcccggcctggactac
cacaagtgggcgcgcgaggaggacgtggtgtcgctcgacgcctaccccgaccccagcgac
gcggccccgcacctcgacgcgggcatgagctacgacctgatgcgctcgttgcgcggcggc
cagcgctggatcctgatggagcaggcccccagcgccgtgaactggcgccagcacaacgcg
cccaagcggccggggctgatgcgggtcctgaaccatcaggcgctcgcacacggggccagc
ggcctgatgtatttccagtggcgggcgtcacgcgccggggccgagaagtaccacagcggc
atggtgcagcacgtcggccccgagcgctcgcgggtatggcgtgaggtcagggcgctgggc
caggaactcaagtcgctctcggccctgaccggggccagcgtgcgttcgcgcgtggccgtc
atgttcgactgggacaactggtgggcgctggaactcgacagcaagccctcggccctcaag
ctcatgcccctggtgcgcaagtggtacgcggcgctgcgcggcctgggccagaacgtggac
ttcgtgcatccggaggccgacctgggcgcctacgacgtggtggcgctgcccaacggctac
ctgctgacggcgggggcggcgggcaacctgcgcgccttcgtgcaggggggcgggaccctg
ctcacgggctttttcagcggcatcgtggacgagcacgagcacgtgcaactcggcggctac
ccgggcctgctgcgcgacgtgctgggcctgtgggtcgaggaatgggcgcccctgcaaccc
ggcgagacgacggcggtccggctggaggggggtgaggaggtccaggccacgcagtgggcc
gaagtcatccacccggacggggcccaggtactcgccaccttcacggaggactactacgcg
ggcggcgcggccgtcacccggcacgccttcggggcggggcaggcctactacctgggcagc
gacctgccgcaatacacgctggccgggctgctggaaggggcgctgcgaggcgcgggcgtg
ccgctgtgccacgtgcccgaacagctcgacctgtcggtgtctaccctggacggcgcgcag
gtgctgcacctgttgaacgtccacccgacccgccccctcaccctgaggctgcctgagggc
ggcgctcgcctgggcggagacgacgtgtcgtcccagacggtggttctggcaccctacgcg
gccgagctgatccgcttccggggcgaggtggacctcgtggccgtgcaggtgctggaccag
gagccggtggcagacaagcgtcaggcgggtctgccggttcccggctga

DBGET integrated database retrieval system