KEGG   Deinococcus gobiensis: DGo_PA0308Help
Entry
DGo_PA0308        CDS       T01827                                 

Definition
ROK family member transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DGo_PA0308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_PA0308
   00052 Galactose metabolism
    DGo_PA0308
   00500 Starch and sucrose metabolism
    DGo_PA0308
   00520 Amino sugar and nucleotide sugar metabolism
    DGo_PA0308
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DGo_PA0308
   00524 Butirosin and neomycin biosynthesis
    DGo_PA0308
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DGo_PA0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:352225..353142
Genome map
AA seq 305 aa AA seqDB search
MSAAALALDVGGSHVTAGLVDLDTRQVRRTARRSVHHSAPADTLLDAWTQAALEACAGDG
QDTVQIGVAVPGPFDARSGRSQMRHKFPGLYDVALRPLLAARLRGQVGPQGTVPEIVFGN
DADLFALGEWWSAGADPRARLIGLTLGTGLGSGFVAGGRVVTSGADVPPGGELWNMPAGD
PQVGPGILEDHACGRTLERLGEEALGERLPAVVLAQRAEDGDRLARAAFRQFGHGLGTLL
RPWAERFGADTVVLGGSVSWAFGLFGPEVARALPGCQVRQSRAFELAPLLGAAALAHAAR
SGQDG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcggcgctggccctggacgtgggcggcagccacgtcacggccgggctggtg
gacctggacacccggcaggtgcggcgcacggcccggcgcagcgtgcaccacagcgcgcca
gccgacaccctgcttgacgcctggacccaggccgcactggaagcctgcgccggggacggc
caggacaccgtacagatcggggtggccgttcccggccccttcgacgcgcgcagcggccgc
tcgcagatgcgtcacaagtttcccggcctgtacgacgtggccctgcggcccctgctggcc
gcgcggctgcgggggcaggtgggtccccagggcaccgtgcccgagatcgtgttcggcaac
gacgccgacctcttcgcactgggcgagtggtggagcgccggggccgatccgcgcgcgcgc
ctgatcggactgaccctggggaccggcctggggtcgggcttcgtggctgggggccgggtc
gtcacctcgggcgcggacgtgccccccggcggcgagctgtggaacatgccggccggcgac
ccgcaggtcgggcccggcatccttgaggaccacgcctgcgggcgcaccctcgaacggctg
ggcgaggaggcgctgggcgagcgcctgcccgccgtggtgctggcccagcgcgccgaggac
ggcgaccggctggcgcgggcggcgttccggcagttcgggcacggcctgggcacgctgctg
cgcccctgggccgagcgctttggggccgatacggtggtgctgggcggcagcgtgagctgg
gccttcggactgttcgggccggaggtcgcccgcgccctgcccggctgtcaggtgcgccag
agccgcgccttcgagctggccccgctgctgggcgcggcggcactggcccacgcggcccgg
tcgggccaggacggttga

DBGET integrated database retrieval system