KEGG   Deinococcus gobiensis: DGo_PA0308Help
Entry
DGo_PA0308        CDS       T01827                                 

Definition
(GenBank) ROK family member transcriptional repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dgo  Deinococcus gobiensis
Pathway
dgo00010  Glycolysis / Gluconeogenesis
dgo00052  Galactose metabolism
dgo00500  Starch and sucrose metabolism
dgo00520  Amino sugar and nucleotide sugar metabolism
dgo00521  Streptomycin biosynthesis
dgo01100  Metabolic pathways
dgo01110  Biosynthesis of secondary metabolites
dgo01120  Microbial metabolism in diverse environments
dgo01130  Biosynthesis of antibiotics
dgo01200  Carbon metabolism
Module
dgo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DGo_PA0308
   00052 Galactose metabolism
    DGo_PA0308
   00500 Starch and sucrose metabolism
    DGo_PA0308
   00520 Amino sugar and nucleotide sugar metabolism
    DGo_PA0308
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DGo_PA0308
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DGo_PA0308
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DGo_PA0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AFD27194
UniProt: H8H0E2
Position
P1:352225..353142
Genome map
AA seq 305 aa AA seqDB search
MSAAALALDVGGSHVTAGLVDLDTRQVRRTARRSVHHSAPADTLLDAWTQAALEACAGDG
QDTVQIGVAVPGPFDARSGRSQMRHKFPGLYDVALRPLLAARLRGQVGPQGTVPEIVFGN
DADLFALGEWWSAGADPRARLIGLTLGTGLGSGFVAGGRVVTSGADVPPGGELWNMPAGD
PQVGPGILEDHACGRTLERLGEEALGERLPAVVLAQRAEDGDRLARAAFRQFGHGLGTLL
RPWAERFGADTVVLGGSVSWAFGLFGPEVARALPGCQVRQSRAFELAPLLGAAALAHAAR
SGQDG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggcggcgctggccctggacgtgggcggcagccacgtcacggccgggctggtg
gacctggacacccggcaggtgcggcgcacggcccggcgcagcgtgcaccacagcgcgcca
gccgacaccctgcttgacgcctggacccaggccgcactggaagcctgcgccggggacggc
caggacaccgtacagatcggggtggccgttcccggccccttcgacgcgcgcagcggccgc
tcgcagatgcgtcacaagtttcccggcctgtacgacgtggccctgcggcccctgctggcc
gcgcggctgcgggggcaggtgggtccccagggcaccgtgcccgagatcgtgttcggcaac
gacgccgacctcttcgcactgggcgagtggtggagcgccggggccgatccgcgcgcgcgc
ctgatcggactgaccctggggaccggcctggggtcgggcttcgtggctgggggccgggtc
gtcacctcgggcgcggacgtgccccccggcggcgagctgtggaacatgccggccggcgac
ccgcaggtcgggcccggcatccttgaggaccacgcctgcgggcgcaccctcgaacggctg
ggcgaggaggcgctgggcgagcgcctgcccgccgtggtgctggcccagcgcgccgaggac
ggcgaccggctggcgcgggcggcgttccggcagttcgggcacggcctgggcacgctgctg
cgcccctgggccgagcgctttggggccgatacggtggtgctgggcggcagcgtgagctgg
gccttcggactgttcgggccggaggtcgcccgcgccctgcccggctgtcaggtgcgccag
agccgcgccttcgagctggccccgctgctgggcgcggcggcactggcccacgcggcccgg
tcgggccaggacggttga

DBGET integrated database retrieval system