KEGG   Deinococcus gobiensis: DGo_PA0357Help
Entry
DGo_PA0357        CDS       T01827                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dgo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:402547..404064
Genome map
AA seq 505 aa AA seqDB search
MDASAPDCVLAIDQGTSGTKCLLVDGAGRIVARGHAPLSEQHPQPGWVNQNPEELWQSVQ
AAVRACLQGQEPSRVRAVGLSTQRESYLLWDRRGGQAISPLISWQDQRAPLSEELRRPET
GQLVRSRSGLPLDPMFSASKAAWLLDTYDPERERSGRGEWCLGTVDSWLLFRMTGEHLTE
LGNASRTQLLNVHTAEWDPELLRLFRVPRAALPELRPSNGPFPALRGLAPLPDGTPIRAV
LGDSHAALFAHGAFSPGAVKATYGTGSSVMGLLHDAQQLDPGLCLTVAWSMGDQVQLAAE
GNVRSTGAGLKWVAELLGLSPAELAALARTVGHSPVTLVPGFGGLGAPWWDEGAVGLISN
LTLGSTRADLAFAAVDSIAQQVSDVVEAVNRSVGQIQVLYTDGGATANPDLMQRQADLID
TAVLRSENAELSALGAAHLAGLGAGLWDAQALRDLPRERQTFRPQITAAERLRLRRVWRE
AVDRARTPQPASPDAAALTSQATRY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttccgcccctgactgcgtgctggcgatcgaccagggcaccagcggcaccaaa
tgcctgttggtggacggcgccggccggatcgtcgcgcggggtcacgctcccctttccgaa
cagcatccccagccgggatgggtcaaccagaaccccgaggaactctggcagagcgtgcag
gcagccgtccgggcgtgccttcaggggcaggaaccgtcgcgggtccgggctgtgggcctg
agcacccagcgggaatcctacctgctctgggaccggcgcggcggccaggccatctccccg
ctgatcagctggcaggaccagcgcgccccgctctccgaggaactgcgccggccggaaacg
gggcaactggtccgcagccgcagcggcctgcccctagaccctatgttctcggccagcaag
gcggcctggctgctcgacacctacgatccggagcgcgaacgcagcggacgcggcgagtgg
tgcctgggcacggtggattcctggctgctgttcaggatgacgggcgagcacctcaccgaa
ctcggcaacgcctcgcgcacgcagctcctgaacgtccacaccgccgagtgggaccccgaa
ctcctgcggctgttccgggtgccgcgcgccgcgctgcccgaactgcggccgagcaacggg
ccctttcccgccctgcgcggtctggcccccctgcccgacggcacgcccatccgggccgtg
ctgggcgactcgcacgcggcgctgttcgcccacggggccttcagcccgggcgcggtcaag
gcgacctacggcacgggctcctcggtgatggggctgctccacgacgcgcagcagctcgat
ccgggactgtgcctgaccgtcgcctggagcatgggcgatcaggtccagctggcggccgag
ggcaacgtccgttcgaccggggccggcctgaaatgggtcgcggagctgctgggtctgagt
ccggccgaactcgcggccctcgcccgcacggtcgggcacagcccggtcacgctcgttccg
ggcttcggcggcctcggcgcgccctggtgggacgagggcgcggtgggcctgatcagcaac
ctcaccctgggcagcacccgcgcggacctggccttcgccgccgtcgattccatcgcccag
caggtcagcgacgtggtcgaggccgtcaaccgcagcgtgggccagattcaggtgctctac
accgacggtggagcgacggccaacccggacctgatgcagcgtcaggccgacctcatcgac
acggcggtgctgcgttccgagaacgccgaactctccgcactgggcgcggcgcacctggca
ggcctcggggcagggctctgggacgctcaggcgctgcgcgacctgccccgcgagcggcag
accttccggccccagatcaccgctgccgaacgtctgcggctacgccgcgtctggcgggag
gccgtcgaccgggcccgcacgccccagcccgcgtctccggacgccgctgcgctgacctcc
caggccacgaggtactga

DBGET integrated database retrieval system