KEGG   Deinococcus gobiensis: DGo_PA0357Help
Entry
DGo_PA0357        CDS       T01827                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dgo  Deinococcus gobiensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    DGo_PA0357
Enzymes [BR:dgo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     DGo_PA0357
Exosome [BR:dgo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DGo_PA0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P1:402547..404064
Genome map
AA seq 505 aa AA seqDB search
MDASAPDCVLAIDQGTSGTKCLLVDGAGRIVARGHAPLSEQHPQPGWVNQNPEELWQSVQ
AAVRACLQGQEPSRVRAVGLSTQRESYLLWDRRGGQAISPLISWQDQRAPLSEELRRPET
GQLVRSRSGLPLDPMFSASKAAWLLDTYDPERERSGRGEWCLGTVDSWLLFRMTGEHLTE
LGNASRTQLLNVHTAEWDPELLRLFRVPRAALPELRPSNGPFPALRGLAPLPDGTPIRAV
LGDSHAALFAHGAFSPGAVKATYGTGSSVMGLLHDAQQLDPGLCLTVAWSMGDQVQLAAE
GNVRSTGAGLKWVAELLGLSPAELAALARTVGHSPVTLVPGFGGLGAPWWDEGAVGLISN
LTLGSTRADLAFAAVDSIAQQVSDVVEAVNRSVGQIQVLYTDGGATANPDLMQRQADLID
TAVLRSENAELSALGAAHLAGLGAGLWDAQALRDLPRERQTFRPQITAAERLRLRRVWRE
AVDRARTPQPASPDAAALTSQATRY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggacgcttccgcccctgactgcgtgctggcgatcgaccagggcaccagcggcaccaaa
tgcctgttggtggacggcgccggccggatcgtcgcgcggggtcacgctcccctttccgaa
cagcatccccagccgggatgggtcaaccagaaccccgaggaactctggcagagcgtgcag
gcagccgtccgggcgtgccttcaggggcaggaaccgtcgcgggtccgggctgtgggcctg
agcacccagcgggaatcctacctgctctgggaccggcgcggcggccaggccatctccccg
ctgatcagctggcaggaccagcgcgccccgctctccgaggaactgcgccggccggaaacg
gggcaactggtccgcagccgcagcggcctgcccctagaccctatgttctcggccagcaag
gcggcctggctgctcgacacctacgatccggagcgcgaacgcagcggacgcggcgagtgg
tgcctgggcacggtggattcctggctgctgttcaggatgacgggcgagcacctcaccgaa
ctcggcaacgcctcgcgcacgcagctcctgaacgtccacaccgccgagtgggaccccgaa
ctcctgcggctgttccgggtgccgcgcgccgcgctgcccgaactgcggccgagcaacggg
ccctttcccgccctgcgcggtctggcccccctgcccgacggcacgcccatccgggccgtg
ctgggcgactcgcacgcggcgctgttcgcccacggggccttcagcccgggcgcggtcaag
gcgacctacggcacgggctcctcggtgatggggctgctccacgacgcgcagcagctcgat
ccgggactgtgcctgaccgtcgcctggagcatgggcgatcaggtccagctggcggccgag
ggcaacgtccgttcgaccggggccggcctgaaatgggtcgcggagctgctgggtctgagt
ccggccgaactcgcggccctcgcccgcacggtcgggcacagcccggtcacgctcgttccg
ggcttcggcggcctcggcgcgccctggtgggacgagggcgcggtgggcctgatcagcaac
ctcaccctgggcagcacccgcgcggacctggccttcgccgccgtcgattccatcgcccag
caggtcagcgacgtggtcgaggccgtcaaccgcagcgtgggccagattcaggtgctctac
accgacggtggagcgacggccaacccggacctgatgcagcgtcaggccgacctcatcgac
acggcggtgctgcgttccgagaacgccgaactctccgcactgggcgcggcgcacctggca
ggcctcggggcagggctctgggacgctcaggcgctgcgcgacctgccccgcgagcggcag
accttccggccccagatcaccgctgccgaacgtctgcggctacgccgcgtctggcgggag
gccgtcgaccgggcccgcacgccccagcccgcgtctccggacgccgctgcgctgacctcc
caggccacgaggtactga

DBGET integrated database retrieval system