KEGG   Deinococcus gobiensis: DGo_PB0103Help
Entry
DGo_PB0103        CDS       T01827                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dgo  Deinococcus gobiensis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dgo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dgo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P2:77791..80427
Genome map
AA seq 878 aa AA seqDB search
MPDLLTRCTIMPVVQITDGQPLRANRVHIPPPGHSLSLEGGILRLEDLTQAGGHVIDYFF
ESLAADQQGQAVGIVLSGLGRDGTRGIGAIKRAGGWVLVEDPQTAEYSDMPRSAVSTGLA
DDVQPAPELAARLMGLTDVAPLLEEALGQGGDGSSAPLQTILRLVHAHSGHNFEHYKHAM
LIRRIDRCMRERGIGDVSDYIQMLEASPDAVEALFQDFTINVTSFFRDAEAFEALKVHLR
SAIRNHGRGQNPFRVWVTACSTGEEAYSVAIVLHELAGELVGDHRPRVQVFATDIDPVVV
NTARQGLYPRDIAYIVSEERLQRFFQLRGDQYQVRAEVRNSVVFATHSTFADPPFTRLDL
VSCRNLLIYVGPELQRQILTLFRYALRPAGLLFLGSSESLGTGQQGFTILDRHWKIYERG
EGEAGRPPLNPSSPLHAGETPLSSEAALKAGPGRISSAGRPAGHLDLTPQVQSALLAEYA
PPAVVVSGQGEVLFVHGRASRYLAIPQGQVQNNVFEMVPVSLRLALRSAVREAHHAQRRV
TYRGLVAAPPGEVDTAPAQTLDLTVRPLWPAGDGPLLITLQETGEAAAEAAEAERASDAG
HSLALELELRHGREALRATVEEVTRSVVELRTSHEDLQTSHEELQSANEELMTSKEELQS
LNEELSTVNAEHQVIIQDQVRANDDLNNLLDTAGTAILFLGNDLTIRRFTPPINQLVRLM
SADVGRPLEDFNVLLRHNMLLAETQRVLETLEPHEAQVQTLDGEWFLLRINPYRTADNRI
DGVVVALTSIAVVKALEWRLVKSLNLDRAALDTRRDPLLLLDQHLRVVTASQALLTLLES
EPDTGELAFDLPELRRRLQAVIATGEPASGSAKLRIEE
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgccggaccttctgacgcgctgcaccatcatgcccgtggtccagatcacggacggccag
cccctgcgtgccaaccgcgtccacattcctcctccgggccacagcctgagcctggagggc
ggaatactgcgcctcgaagacctgacacaggcgggcggccacgtgatcgactattttttc
gagtcgctggctgctgatcagcaggggcaggcggtaggcatcgtgctgtcggggctgggc
cgggacggcacgcggggcatcggcgccatcaagcgggcgggcgggtgggtgctggtcgag
gacccgcagaccgccgagtattccgacatgccccgcagtgcagtcagtacagggctggcg
gacgacgtacagcccgccccggaactcgcggcccgcctgatgggcctaacagatgtggcc
ccgctgctggaggaggcactgggtcagggtggggacggctccagcgcgccgctacaaacg
atcctgcggctggtccacgcccacagcggccataatttcgagcattacaagcacgccatg
ctgatccgccgcattgaccgctgcatgagggagcgggggattggggacgtctccgattac
atccagatgttggaagcgtcgccagacgcggtcgaggcgctgtttcaggattttaccatc
aacgtgaccagcttcttccgggacgccgaggccttcgaggccctgaaagtccacctaaga
agtgccatccggaaccacgggcgggggcagaacccattcagggtctgggtcaccgcctgc
tcaaccggcgaagaggcgtactcggtcgccatcgtgctgcacgaactggctggggagctg
gtgggcgatcaccgcccaagggtgcaagtcttcgcgaccgacattgatccggtggtcgtg
aacactgcccggcagggtctgtatcccagggacatcgcttacatcgtgtcggaagagcgc
ctgcaacgcttttttcagcttaggggcgaccagtatcaggtgcgggccgaggtccggaac
agcgtggtcttcgccacccacagcaccttcgccgatccgccgttcacgcgcctggatctc
gtgagctgccgcaacctactgatctacgttggccccgagctgcaacggcagatcctgacg
ctgtttcgctacgccctcagacccgccggcctgctgttcctcgggtccagcgagtcgctt
ggcaccggtcagcaggggttcactatccttgaccggcactggaagatctacgagcgtggc
gagggtgaggcgggccgaccgccactgaatccctcatccccattacacgccggcgagacg
ccgctcagtagcgaggctgccttgaaagccgggccgggtcggatcagttctgctggccgc
cctgccggccacctcgatctgaccccgcaggtgcagtccgccctactggccgaatacgcc
ccgccggcggtggtggtcagcgggcagggcgaggtgctgttcgtgcatggccgcgccagc
cgctatctggcaatcccgcaggggcaggtacagaacaatgtgttcgagatggtgccggtc
agcctgcgcttggcactgcgctccgccgtgcgcgaagctcaccacgcgcagcggcgggtg
acgtaccggggtttggtggccgcgccaccaggggaggtcgacacagccccggcccagacg
ctcgacctgaccgtccggcccctttggcccgccggcgatgggccacttctgatcacgttg
caggaaaccggcgaggccgccgccgaggccgccgaggcagagcgcgccagcgacgccggg
cacagcctggccttggagctagaactccgacacggacgcgaggcgctgcgggccacggtc
gaggaggtgacccgctcggtggtggagctccggaccagccatgaggacctccagaccagc
catgaggagcttcagagcgcgaatgaagagctgatgacctcaaaggaggagctccagtcg
ctcaatgaggagctgagcactgtgaacgccgagcatcaggtcatcatccaagatcaggtg
cgcgccaacgacgacctgaacaacctgctggacacggcgggcacggccatcctctttcta
ggcaacgacctgaccatccggcggttcaccccacctattaaccagctcgtacgcctcatg
tcggccgacgtgggccggccgctggaagacttcaacgtcctgctgcgtcacaatatgctg
ctggcggagacccaaagggtgcttgaaaccctggaaccccacgaggcacaggtgcagacc
ctggacggggagtggttcctgctgcggatcaatccctaccgcacggcggacaaccgcatt
gacggcgtggtggtggccctgaccagtatcgctgtggtcaaggcgctagaatggcgactg
gtcaagtcgctgaacttggatcgagcggcgcttgacacgaggcgtgaccctttgctgctg
ctggatcagcacctgcgcgtcgtaacggccagccaagccctgctgacgctgctagaaagt
gagccagacaccggggaactcgcctttgacctgcctgaactgcgccgccggttgcaggcg
gtcattgcgacaggggagccggcgtctgggtcggcgaagttacggattgaggagtaa

DBGET integrated database retrieval system