KEGG   Deinococcus gobiensis: DGo_PB0105Help
Entry
DGo_PB0105        CDS       T01827                                 

Gene name
cheB
Definition
Protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dgo  Deinococcus gobiensis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DGo_PB0105 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DGo_PB0105 (cheB)
Enzymes [BR:dgo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DGo_PB0105 (cheB)
Two-component system [BR:dgo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   DGo_PB0105 (cheB)
Bacterial motility proteins [BR:dgo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DGo_PB0105 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P2:82028..83086
Genome map
AA seq 352 aa AA seqDB search
METQRVIVIGTSAGGMQPLLELAAGLPADFPAAVCIVMHIPAYIPSFLPNILGRAGPLSA
VHPANGDPILPGRIYCAPPDQHLLIENGRLNLTRGPKENRMRPAVDTLFRSAAYSAGSNV
IGVVLSGLLDDGTSGLWAIKQFGGTTVVQDPRDAQFDSMPASALNQVQIDHVVTARHLAA
LLVQLVAEPVQAPREAGMNEQVRKRLITEISIASGGHAFKKGVMTFGKVTPQTCPECGGV
LVQIQEGGFTRYRCHTGHAYTGDTLLVSVTEAIEDKLWATLRALEEASMLLENTGQEFEA
AGNARLAGEYRRRAKEMEARSALIFENVARNRSLSVEQLEYEASQKESPQSD
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggagacacagcgggtaatcgtgattgggacatcggcgggcgggatgcagccgctgctt
gagctcgcagctggcctgcccgctgactttccggcggcggtgtgtatcgtcatgcacatc
ccggcctacataccaagttttctgcctaatatcctaggccgcgccgggccgctctccgcc
gtgcacccggcgaatggcgatccgatattgccgggccggatctattgtgcgccgcccgat
caacacctgctgatcgagaacgggcgcctcaacctgacccgggggcccaaggaaaaccgg
atgcggccagccgtcgacaccctgttccgctcggcggcgtacagcgccggctcgaacgtg
atcggggtggtgctgtctggcctgctagacgacggcacctccggcctctgggctatcaag
cagttcggcggcaccaccgtggtccaagacccacgtgacgctcagttcgactcaatgccg
gcgagtgctctgaatcaggtccagatcgaccacgtggtgaccgcgcggcaccttgcggcc
ctgctggtccagctagtcgccgagcccgtgcaagctccaagggaggccggaatgaacgaa
caggtccggaagcggctgatcaccgagatcagtatcgccagcggcggccacgctttcaag
aagggcgtcatgacgttcggcaaggtcacgccgcagacctgtccggagtgcggcggcgtg
ctggtgcagattcaggaaggggggttcacgcgctaccgctgtcataccgggcatgcctat
accggcgacaccctacttgtcagcgtgacggaggccatcgaggacaaactgtgggccacc
ctgcgggcgctggaagaagccagcatgctgttggagaacaccggccaggagtttgaggcg
gccgggaacgcccggctggccggggaataccggcgcagggccaaagagatggaagcccgc
agcgcgctcatttttgagaacgttgctcgcaaccggagcctgagcgttgagcaactggag
tacgaggctagtcagaaggagtcgccccagtcagactga

DBGET integrated database retrieval system