KEGG   Deinococcus gobiensis: DGo_PB0521Help
Entry
DGo_PB0521        CDS       T01827                                 

Gene name
cypD
Definition
Bifunctional P-450:NADPH-P450 reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
dgo  Deinococcus gobiensis
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dgo00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    DGo_PB0521 (cypD)
  Amino acid metabolism
   00380 Tryptophan metabolism
    DGo_PB0521 (cypD)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    DGo_PB0521 (cypD)
Enzymes [BR:dgo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     DGo_PB0521 (cypD)
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     DGo_PB0521 (cypD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
P2:420704..423880
Genome map
AA seq 1058 aa AA seqDB search
MTLPIPAPQALPVLGHLLAIDAQSPVQSLTRLLRDHGPIAELRLPGRRKGGRLIVVGSYA
LADELSDQERFDKQVHDDLEEIRAFAGDGLFTAETAEPNWRRAHNILMPAFGPLAIRGMF
GQMQDVCEQMLLRWERFGPAAEFDVADQMTRLTLDTIALCAFDYRFNSFYLERMHPFVDA
MVGALDVAGKGGLSSNPLHLNRNRQYRHDLAAIREIADDLIRQRQADPQADEKDDLLALM
LRGRDPETGEGLSLENVRNQMVTFLIAGHETTSGLLSFAVHFLLRDPEVLRRAREEVDRV
LGDRAVRVTDLPKLTYLDQVLRETLRLWPTAPAFGLRPRARTIIGGRYEVYTDDTLLVLL
PALHRDLAVWGPDVDRFDPERFAPGALEALPTNAWKPFGNGQRACIGQPFAMQEALLVLA
SVLQRFDLTAARPDAPLKVKETLTLKPHDLRLRARLRGGTARPGQPDPADQSVAQITPTG
GGGPLTAEGIQLLVLYGSESGASEGFARQIAGDAAAHGCQATVHSLDEQAGTGSLPTQGA
VVIVTSSYSGQPPANARRFMAWAQSLDAGALAGVQYAVFGCGNRDWAATYQAVPKQLDAL
LEDAGARRFCGRGEADARGDFFGGFADWYTTFWIEFGTAFGPLQTPAPGPATDAGAQIQR
GARPRLLRQGDLQTGRVTANRELVSPDHPQGRSKRHLDIELPEGMTYRAGDYLAVLPDNP
ADLVERVLRRFNVAPDDQVAQAGRALGFLPGDLTLSAGDLLTHYTELTQPATRRQVERLR
DATRCPPERQILAALADGYDTEVLAQRLSVLDLLERVQGCELDFAEFLEMLPPLRARQYS
VSSSPLLRPGGCSLTVAVVDAPAHSGTGRFRGVASGYLQGAQPGTRLTVAVRPSADAFHL
PEDSATPLILVCAGTGVAPFRGFLEERALRQAGGETVGEALLFFGCDHPDLDFLYRDELL
AWQERGVVSVRPAFSQQPEDGVEFVQHRLWQDRADVARLFRQGAHLYVCGDGRFMAPAVR
ETLVRIYQEETGVTEADAQAWAEAFGRDSGRYAADVFA
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgaccctacccatcccggccccccaggccctgcccgtcctcggtcatctgcttgccatt
gacgcacagtcccccgtccagagcctgacgcgcctgctgcgcgaccacgggccgattgcc
gagctgcggctaccgggtcgccggaagggcgggcggcttatcgtggtcggatcctacgcg
ctggccgacgaactcagcgaccaggagcgcttcgacaagcaagtccacgacgacctggag
gagatccgggccttcgcgggtgacgggctgttcacggccgagacggcggaacccaactgg
cgacgggcgcacaacatcctgatgccggctttcgggccgctcgccattcgcgggatgttc
gggcagatgcaggacgtctgcgagcagatgctgctgcgctgggagcgcttcgggcctgcc
gcggagtttgacgtggccgatcagatgacccgcctgaccctggataccatcgccctatgc
gccttcgactaccgcttcaattccttttaccttgagcggatgcaccccttcgtggacgcg
atggtgggcgcgctggacgtggcgggcaagggcggcctgagcagcaacccgctgcacctg
aaccgcaaccgacagtaccgccacgatctcgccgccatccgcgagatcgccgacgacctc
atccggcagcggcaggccgacccgcaggcagacgagaaggacgacctgctggccctgatg
ctgcgcggccgcgaccccgaaacgggcgagggcctgagcctggagaatgtccgtaaccag
atggtcacgttcctgatcgccgggcacgagaccaccagcggcctgctgtccttcgcggtg
catttcctgctgcgcgaccccgaggtgctgcggcgtgcccgcgaggaggtggaccgcgtg
ctgggcgaccgcgccgtgcgggtcacggacctgcccaaactgacctatctggaccaggtg
ctgcgcgagacactgcggctgtggccgaccgcgcccgccttcgggctgcgcccccgcgcc
cgcacgatcatcggcggccgttacgaggtctacaccgacgatacgctgctcgtgctccta
cccgcgctgcaccgcgacctggcggtgtgggggccggacgtggaccgcttcgacccggag
cggttcgcgcccggcgccttagaggcgctgcccaccaacgcctggaaacccttcggcaac
ggccagcgtgcctgtatcgggcaacccttcgcgatgcaagaagccctgctcgtgctggcc
tcggtgttgcagcgcttcgacctgacggcggcgcggccggacgcaccactcaaggtcaag
gagaccctgaccctcaagccccacgacctacgtctgcgcgcccggctgcgtggggggacc
gcccggcccggccagcctgacccggctgaccagagcgtcgcccagatcacccccaccgga
ggcggcggcccccttacggctgagggtatccaattacttgtgctgtatggttcagagagc
ggcgccagcgagggcttcgcgcgccagatcgccggggacgccgccgcgcacggctgtcag
gccaccgtgcacagcctcgacgaacaggccggaaccggcagcctgcccacccaaggcgcg
gtcgtgatcgtcacgtcgtcgtactcggggcaaccgcccgccaacgcccggcgcttcatg
gcatgggcgcagtcgctggacgcgggggcgctggccggtgtgcagtacgctgtgttcggc
tgcggcaaccgcgactgggccgccacctaccaggccgtgcccaagcaactcgacgccctg
ctggaagacgcgggcgcccggcgcttctgcgggcgaggcgaggccgacgcgcgcggcgac
ttcttcgggggcttcgccgactggtacaccaccttctggatcgagttcgggacagcgttc
gggccgctgcagacccctgcacccggcccggccaccgatgccggggcgcagatccagcgt
ggtgcacgccccaggctgctgcgccagggcgacttgcagaccgggcgcgtgaccgccaac
cgcgaactggtgagccccgaccacccgcagggccgttccaagcgccacctcgatatcgaa
ctgccggagggcatgacttaccgggccggggactacctggccgtcctgcccgacaacccg
gccgacctcgtcgagcgggttctgcggcgctttaacgtggcccccgacgatcaggtggcc
caggccggccgggcgttgggtttcctgccgggcgacctgaccctgagcgccggggacctg
ctgacccactacaccgaactgacacagccggccacgcgccggcaggtcgagcggttgcgc
gatgccacgcgctgtccgcccgaacggcaaatactcgccgcgctggccgacgggtacgac
accgaggtgctcgcccagcgcctgagtgtgctggacttactggaacgggtgcagggttgc
gaactggacttcgccgaatttctggagatgctgccgccactgcgggcccggcagtactcg
gtctcatcatcgccgctgctgcggccgggggggtgcagcctgacggtcgcggtcgtggac
gccccggcccactcgggcaccgggcgcttccggggggtggcctcgggctacttgcagggc
gcacagccgggcacgcggctcactgtggcagtgcggccctcggctgacgcttttcaccta
ccagaagactcggcgaccccgcttatcctggtctgtgccgggaccggcgtcgcgcccttc
cggggctttctggaggagcgcgccctgcggcaggctgggggcgagaccgtcggtgaggcg
ctgctctttttcggctgcgaccatcccgatctggatttcctgtaccgcgacgaactgctg
gcgtggcaggagcgcggggtggtgagcgtgcgcccggccttctcgcagcagcccgaggac
ggcgtagagttcgtgcagcaccggctatggcaggaccgcgcggacgtcgctcgcctgttc
cggcagggtgcccacttgtatgtgtgcggtgacggccgcttcatggccccggcggtgcgc
gagacgctcgtgcggatctatcaggaggaaacgggcgtgaccgaagcggacgctcaggcc
tgggccgaagccttcgggcgggattcgggacgctacgctgccgatgtgttcgcctga

DBGET integrated database retrieval system